Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
|
>gb|AAO52258.1| similar to Plasmodium falciparum. Hypothetical protein [Dictyostelium discoideum] Length = 212 Score = 77.1 bits (174), Expect = 1e-012 Identities = 37/86 (43%), Positives = 47/86 (54%) Frame = +2
Y GT CHGKF + VA+LNFFQ HSTV+V RIVD D Sbjct: 143 YIGTPCHGKFFSFNNVAVLNFFQPHSTVIVTYRIVDQDT--------------------- 181
M+VC++EVDEKQ P++QY ++ Sbjct: 182 -----MSVCVVEVDEKQTPSIQYGNM 202 Score = 66.2 bits (148), Expect = 2e-009 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 77 M*IEEYHKVDAEPGARHLKWSFGKSLSKSELHFGYIMK 190 M IEE+ K D EPG+R+LKWSFGKS +K+ELHFGY MK Sbjct: 90 MRIEEFTKYDTEPGSRNLKWSFGKSFNKNELHFGYTMK 127 ----------- gnl|ti|820218824 name:POAA-aaa70g11.g1 mate_pair:818417648 (894 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAO52258.1| similar to Plasmodium falciparum. Hypothetic... 66 2e-009 ref|XP_643862.1| hypothetical protein DDB0217641 [Dictyoste... 61 1e-007 emb|CAG01157.1| unnamed protein product [Tetraodon nigrovir... 37 1.3 ref|XP_667157.1| replication factor C subunit 1 [Cryptospor... 35 4.1 ref|ZP_00512238.1| conserved hypothetical protein [Chlorobi... 35 4.1 >gb|AAO52258.1| similar to Plasmodium falciparum. Hypothetical protein [Dictyostelium discoideum] Length = 212 Score = 66.2 bits (148), Expect = 2e-009 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2
M IEE+ K D EPG+R+LKWSFGKS +K+ELHFGY MK Sbjct: 90 MRIEEFTKYDTEPGSRNLKWSFGKSFNKNELHFGYTMK 127 Score = 60.7 bits (135), Expect = 1e-007 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +2 Query: 575 YTGTVCHGKFLPASGVAILNFFQAHSTVLVVQRIVDADNI 694 Y GT CHGKF + VA+LNFFQ HSTV+V RIVD D + Sbjct: 143 YIGTPCHGKFFSFNNVAVLNFFQPHSTVIVTYRIVDQDTM 182 ------------------ gnl|ti|820218827 name:POAA-aaa70g17.g1 mate_pair:818417651 (640 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAJ08970.1| elongation factor 2 [Leishmania major] >gi|... 107 7e-022 gb|EAN77876.1| elongation factor 2 [Trypanosoma brucei] >gi... 105 2e-021 gb|AAT12563.1| translation elongation factor [Candida inter... 104 5e-021 gb|AAT12548.1| translation elongation factor [Pichia membra... 103 7e-021 gb|AAT12564.1| translation elongation factor [Issatchenkia ... 101 2e-020 ref|XP_651009.1| elongation factor 2, putative [Entamoeba h... 100 6e-020 ref|XP_650528.1| elongation factor 2, putative [Entamoeba h... 100 6e-020 sp|Q06193|EF2_ENTHI Elongation factor 2 (EF-2) >gi|158941|g... 100 6e-020 dbj|BAA04800.1| elongation factor 2 [Entamoeba histolytica] 100 6e-020 dbj|BAB86911.1| elongation factor 2 [Mastigamoeba balamuthi] 99 2e-019 >emb|CAJ08970.1| elongation factor 2 [Leishmania major] emb|CAJ08969.1| elongation factor 2 [Leishmania major] Length = 845
Identities = 43/78 (55%), Positives = 58/78 (74%) Frame = +3
W + EG LC E +RGVR+N+ DVT+HADAIHRGGGQI+P RR+ +AC L +PRL+E Sbjct: 670 WQWATREGVLCDENMRGVRVNVEDVTMHADAIHRGGGQIIPTARRVFYACCLTASPRLME 729
P+++V+I T + G IY Sbjct: 730 PMFVVDIQTVEHAMGGIY 747 --------
gnl|ti|820218849 name:POAA-aaa70k21.g1 mate_pair:818417671 (882 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAX26869.1| unknown [Schistosoma japonicum] 76 3e-012 gb|EAA16547.1| hypothetical protein [Plasmodium yoelii yoelii] 54 1e-005 ref|XP_710281.1| hypothetical protein CaO19.6835 [Candida a... 45 0.007 ref|XP_453836.1| unnamed protein product [Kluyveromyces lac... 43 0.016 dbj|BAD46202.1| hypothetical protein [Oryza sativa (japonic... 43 0.016 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza ... 42 0.050 gb|EAA21329.1| hypothetical protein [Plasmodium yoelii yoelii] 39 0.29 emb|CAB81951.1| integral membrane transporter protein [Homo... 38 0.52 ref|XP_800322.1| PREDICTED: hypothetical protein XP_795229,... 38 0.70 ref|YP_056023.1| exodeoxyribonuclease V beta chain [Propion... 38 0.93 >gb|AAX26869.1| unknown [Schistosoma japonicum] Length = 102 Score = 75.9 bits (171), Expect = 3e-012 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -3
RK +YA G ++R L RS AVLTCKS V+ YRGER IE SSWFPPKFPSG Sbjct: 49 RKMVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRGERLIEPSSSWFPPKFPSG 102 ----------- nl|ti|818417675 name:POAA-aaa70m05.b1 mate_pair:820218853 (894 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAC30857.1| unnamed protein product [Mus musculus] 70 1e-010 gb|AAH71604.1| N-acyl-phosphatidylethanolamine-hydrolyzing ... 70 1e-010 ref|NP_955413.1| N-acyl-phosphatidylethanolamine-hydrolyzin... 70 1e-010 ref|NP_848843.1| N-acyl-phosphatidylethanolamine-hydrolyzin... 70 1e-010 dbj|BAD02399.1| N-acyl-phosphatidylethanolamine-hydrolyzing... 70 1e-010 ref|XP_527851.1| PREDICTED: similar to hypothetical metallo... 70 1e-010 emb|CAI56779.1| hypothetical protein [Homo sapiens] 69 3e-010 emb|CAH90414.1| hypothetical protein [Pongo pygmaeus] 69 3e-010 emb|CAG31479.1| hypothetical protein [Gallus gallus] >gi|71... 68 7e-010 emb|CAF97216.1| unnamed protein product [Tetraodon nigrovir... 66 3e-009 >dbj|BAC30857.1| unnamed protein product [Mus musculus] Length = 395 Score = 70.4 bits (158), Expect = 1e-010 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2
F + GDTGYCPAF++ G+ +GPFDLA IPIGAYEPR+ K Sbjct: 278 FFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMK 317 Score = 36.3 bits (77), Expect = 2.3 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 672 RWFMKPQHVDPQEAVQMRIPLK 737 RWFMK QH DP++AV++ I L+ Sbjct: 313 RWFMKYQHADPEDAVRIHIDLQ 334 --------------- gnl|ti|818417189 name:POAA-aaa72p21.b1 mate_pair:818417461 (887 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAB92626.1| probable glutamate synthase (NADPH) [Neuros... 72 3e-011 gb|EAL88447.1| NADH-dependent glutamate synthase (GLT1), pu... 70 2e-010 emb|CAD74361.1| NADH-glutamate synthase small chain [Rhodop... 70 2e-010 ref|XP_367262.1| hypothetical protein MG07187.4 [Magnaporth... 70 2e-010 ref|XP_662738.1| hypothetical protein AN5134.2 [Aspergillus... 69 3e-010 gb|AAL26864.2| NADH glutamate synthase precursor [Phaseolus... 69 4e-010 gb|EAA67906.1| hypothetical protein FG01433.1 [Gibberella z... 68 5e-010 emb|CAJ20840.1| glutamate synthase [Gibberella fujikuroi] 68 5e-010 gb|AAL26865.2| NADH glutamate synthase precursor [Phaseolus... 67 9e-010 gb|AAW82371.1| glutamate synthase precursor [Debaryomyces h... 67 1e-009 >emb|CAB92626.1| probable glutamate synthase (NADPH) [Neurospora crassa] ref|XP_328183.1| probable glutamate synthase [MIPS] [Neurospora crassa] gb|EAA27931.1| probable glutamate synthase [MIPS] [Neurospora crassa] Length = 2116
Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 14/77 (18%) Frame = -2
DC+ TS+RHG +S++NFE LP+PP RG DNPWPQ VK+ GK R Y Sbjct: 1909 DCIGTSVRHGAKSVINFELLPKPPPARGRDNPWPQWPRVYRVDYGHDEVKQHTGKDPREY 1968
+ ++DG G V G Sbjct: 1969 CIMSEEFVDDGNGKVRG 1985 ------------ gnl|ti|818417461 name:POAA-aaa72p21.g1 mate_pair:818417189 (850 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|NP_891373.1| glutamate synthase [NADPH] large chain pre... 73 2e-011 ref|NP_882256.1| glutamate synthase [NADPH] large chain pre... 73 2e-011 ref|NP_886382.1| glutamate synthase [NADPH] large chain pre... 73 2e-011 ref|ZP_00426623.1| Glutamate synthase (ferredoxin) [Burkhol... 72 5e-011 ref|YP_367745.1| Glutamate synthase (ferredoxin) [Burkholde... 71 6e-011 gb|AAV45235.1| glutamate synthase large subunit [Haloarcula... 71 6e-011 ref|ZP_00456785.1| Glutamate synthase (ferredoxin) [Burkhol... 71 6e-011 ref|ZP_00460578.1| Glutamate synthase (ferredoxin) [Burkhol... 71 6e-011 ref|ZP_00690031.1| Glutamate synthase (ferredoxin) [Burkhol... 71 6e-011 ref|ZP_00278187.1| COG0069: Glutamate synthase domain 2 [Bu... 70 2e-010 >ref|NP_891373.1| glutamate synthase [NADPH] large chain precursor [Bordetella bronchiseptica RB50] emb|CAE35203.1| glutamate synthase [NADPH] large chain precursor [Bordetella bronchiseptica RB50] Length = 1579 Score = 72.9 bits (164), Expect = 2e-011 Identities = 27/49 (55%), Positives = 41/49 (83%) Frame = +3
+ GG +V+LG+TG NFAAGMSGG+AYV++P++ F E+CN+ +V+L P+ Sbjct: 1444 YMTGGTVVVLGTTGRNFAAGMSGGVAYVWDPDRTFRERCNSAMVELEPV 1492 Score = 57.7 bits (128), Expect = 7e-007 Identities = 21/47 (44%), Positives = 34/47 (72%) Frame = +1 Query: 511 DESFVKQLVQKHLNYTASLVAKSILDNWDTTRAHFVKVLPTDYKKVL 651 DE+ +++LV+ H YT S A+ IL +W+ +R FVKV+PT+Y++ L Sbjct: 1519 DETILRRLVEDHFRYTGSFRAREILGDWEASRGKFVKVMPTEYRRAL 1565 --------- gnl|ti|820219175 name:POAA-aaa73d02.b1 mate_pair:818417986 (552 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_637789.1| hypothetical protein DDB0186863 [Dictyoste... 57 5e-007 ref|XP_700101.1| PREDICTED: similar to TBP-associated facto... 49 2e-004 gb|AAH29930.1| BTAF1 protein [Homo sapiens] 48 4e-004 dbj|BAD92080.1| BTAF1 RNA polymerase II, B-TFIID transcript... 48 4e-004 ref|NP_003963.1| BTAF1 RNA polymerase II, B-TFIID transcrip... 48 4e-004 ref|XP_507918.1| PREDICTED: BTAF1 RNA polymerase II, B-TFII... 48 4e-004 ref|XP_601966.2| PREDICTED: similar to TATA-binding-protein... 48 4e-004 ref|XP_543929.2| PREDICTED: similar to TATA-binding-protein... 48 4e-004 gb|AAH94345.1| Btaf1 protein [Mus musculus] 46 0.001 ref|XP_129248.6| PREDICTED: RIKEN cDNA E430027O22 [Mus musc... 46 0.001 >ref|XP_637789.1| hypothetical protein DDB0186863 [Dictyostelium discoideum] gb|EAL64285.1| hypothetical protein DDB0186863 [Dictyostelium discoideum] Length = 2005 Score = 57.3 bits (127), Expect = 5e-007 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1
+DMGLGKTL TICI+AGDD++RR NY + T + +PLP Sbjct: 1402 DDMGLGKTLQTICIIAGDDYHRRVNYQEKGTPDFAPLP 1439 Score = 35.4 bits (75), Expect = 2.0 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +1 Query: 364 VLKKDMGLGKTLQTICMIFTGGKATQSHPRRTSTPSLHP 480 +L DMGLGKTLQTIC+I + + + TP P Sbjct: 1399 ILCDDMGLGKTLQTICIIAGDDYHRRVNYQEKGTPDFAP 1437 ---------------- gnl|ti|818417986 name:POAA-aaa73d02.g1 mate_pair:820219175 (907 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_637789.1| hypothetical protein DDB0186863 [Dictyoste... 107 6e-022 ref|NP_190996.1| ATP binding / ATP-dependent helicase/ DNA ... 99 2e-019 ref|XP_464189.1| putative SNF2 domain-containing protein [O... 97 1e-018 gb|EAA01172.3| ENSANGP00000008413 [Anopheles gambiae str. P... 96 2e-018 ref|XP_447036.1| unnamed protein product [Candida glabrata]... 96 3e-018 gb|EAL28421.1| GA18064-PA [Drosophila pseudoobscura] 95 4e-018 ref|XP_760377.1| hypothetical protein UM04230.1 [Ustilago m... 94 1e-017 ref|XP_507918.1| PREDICTED: BTAF1 RNA polymerase II, B-TFII... 94 1e-017 ref|XP_129248.6| PREDICTED: RIKEN cDNA E430027O22 [Mus musc... 94 1e-017 ref|XP_347207.2| PREDICTED: similar to TBP-associated facto... 94 1e-017 >ref|XP_637789.1| hypothetical protein DDB0186863 [Dictyostelium discoideum] gb|EAL64285.1| hypothetical protein DDB0186863 [Dictyostelium discoideum] Length = 2005 Score = 107 bits (247), Expect = 6e-022 Identities = 44/67 (65%), Positives = 56/67 (83%) Frame = -2
R +FKD+ +L+MSYDI+R DI+ + MHFNYC LDEGHIIKNAKTK+ +A +++NHRL Sbjct: 1481 RSKFKDHNVLIMSYDIMRNDIDILSEMHFNYCILDEGHIIKNAKTKLTQAAKRLQSNHRL 1540
ILSGTPI
Sbjct: 1541 ILSGTPI 1547 Score = 56.1 bits (124), Expect = 3e-006 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 250 EEHIIKNAKTKITKAVKLIRANHRLILFGTPIQ 152 E HIIKNAKTK+T+A K +++NHRLIL GTPIQ Sbjct: 1516 EGHIIKNAKTKLTQAAKRLQSNHRLILSGTPIQ 1548
Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2
EG I+KNAKTK+T+A K + +NHRLIL GTPIQ Sbjct: 1516 EGHIIKNAKTKLTQAAKRLQSNHRLILSGTPIQ 1548 ------------ gnl|ti|818418001 name:POAA-aaa73f20.g1 mate_pair:820219191 (898 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAX30301.1| unknown [Schistosoma japonicum] 94 1e-017 ref|XP_453849.1| unnamed protein product [Kluyveromyces lac... 93 2e-017 gb|AAX27748.1| unknown [Schistosoma japonicum] 74 1e-011 emb|CAB51041.1| putative transcription factor [Periplaneta ... 70 1e-010 dbj|BAD26579.1| cytochrome P450 like_TBP [Citrullus lanatus] 67 1e-009 pir||T02955 probable cytochrome P450 monooxygenase - maize ... 56 3e-006 dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 54 1e-005 dbj|BAD18905.1| rRNA intron-encoded endonuclease [Thermopro... 49 4e-004 dbj|BAD18906.1| rRNA intron-encoded endonuclease [Thermopro... 46 0.002 ref|XP_767406.1| hypothetical protein GLP_748_1200_211 [Gia... 46 0.004 >gb|AAX30301.1| unknown [Schistosoma japonicum] Length = 55
Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -3
LI DAHEW+NEIPTVPTYYLAKPQPRERAW N RGKKTLLSLTL Sbjct: 5 LISDAHEWMNEIPTVPTYYLAKPQPRERAWRNQRGKKTLLSLTL 48 ----------- gnl|ti|820219224 name:POAA-aaa73n18.b1 mate_pair:818418037 (721 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_455559.1| unnamed protein product [Kluyveromyces lac... 75 3e-012 emb|CAB02758.2| Hypothetical protein C25A1.3 [Caenorhabditi... 74 9e-012 emb|CAE66861.1| Hypothetical protein CBG12234 [Caenorhabdit... 72 4e-011 ref|XP_480371.1| putative mRNA cap methyltransferase [Oryza... 71 7e-011 ref|XP_719815.1| RNA cap methyltransferase [Candida albican... 70 2e-010 ref|NP_188701.2| S-adenosylmethionine-dependent methyltrans... 70 2e-010 gb|AAF69030.1| mRNA cap methyltransferase Ccm1p [Candida al... 70 2e-010 gb|AAS53346.1| AFL026Wp [Ashbya gossypii ATCC 10895] >gi|45... 70 2e-010 ref|NP_974346.1| S-adenosylmethionine-dependent methyltrans... 70 2e-010 dbj|BAA82446.1| RNA (guanine-N7-) methyltransferase [Candid... 69 2e-010 >ref|XP_455559.1| unnamed protein product [Kluyveromyces lactis] emb|CAG98267.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] Length = 426 Score = 75.4 bits (170), Expect = 3e-012 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = -1
D VSCQF+LHY+FETEE+AR +L N+ LK GGYF GTIPD+ +I Y Sbjct: 241 DIVSCQFALHYAFETEEKARRMLLNVVKSLKIGGYFFGTIPDSEFIRY 288 ----------- gnl|ti|818421399 name:POAA-aaa74e05.b1 mate_pair:820220009 (695 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_645630.1| isocitrate dehydrogenase subunit alpha [Di... 142 2e-032 ref|NP_568113.1| isocitrate dehydrogenase (NAD+)/ oxidoredu... 120 9e-026 gb|AAO61644.1| NAD-dependent isocitrate dehydrogenase alpha... 120 9e-026 emb|CAB83285.1| 3-isopropylmalate dehydrogenase-like protei... 120 9e-026 emb|CAA47720.1| 3-isopropylmalate dehydrogenase [Solanum tu... 119 1e-025 ref|ZP_00521389.1| Isocitrate dehydrogenase NAD-dependent, ... 118 2e-025 emb|CAG32614.1| hypothetical protein [Gallus gallus] 117 4e-025 dbj|BAD96693.1| isocitrate dehydrogenase 3 (NAD+) alpha pre... 117 4e-025 emb|CAH92738.1| hypothetical protein [Pongo pygmaeus] >gi|6... 117 4e-025 emb|CAH90401.1| hypothetical protein [Pongo pygmaeus] 117 4e-025 >ref|XP_645630.1| isocitrate dehydrogenase subunit alpha [Dictyostelium discoideum] gb|EAL71802.1| isocitrate dehydrogenase (NAD+) [Dictyostelium discoideum] Length = 354 Score = 142 bits (329), Expect = 2e-032 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +2
YEEL +DN CMQL L+P+++DVMVLPNLYGDIVSDLCAGLIGGLGLTPSGNI +N SAIF Sbjct: 213 YEELTIDNNCMQLVLDPNQMDVMVLPNLYGDIVSDLCAGLIGGLGLTPSGNIGENGSAIF 272
EAVHGTAPDIAG Sbjct: 273 EAVHGTAPDIAG 284 ----------- gnl|ti|820220019 name:POAA-aaa74g03.g1 (321 letters) Score E
Sequences producing significant alignments: (bits) Value ref|NP_815246.1| GTP-binding protein [Enterococcus faecalis... 59 4e-008 gb|EAN08613.1| GTP-binding protein, HSR1-related:GTP1/OBG s... 56 5e-007 dbj|BAB04932.1| GTP-binding protein involved in initiation ... 55 9e-007 ref|NP_390670.1| GTPase activity [Bacillus subtilis subsp. ... 52 7e-006 ref|ZP_00561556.1| spo0B-associated GTP-binding protein [De... 51 2e-005 emb|CAH56427.1| spo0B-associated GTP-binding protein [Bacil... 51 2e-005 gb|AAU24425.1| GTPase Obg [Bacillus licheniformis ATCC 1458... 50 3e-005 ref|NP_470908.1| hypothetical protein lin1572 [Listeria inn... 49 4e-005 gb|AAV63035.1| GTP-binding protein, GTP1/Obg family [Strept... 49 5e-005 ref|ZP_00388112.1| COG0536: Predicted GTPase [Streptococcus... 49 5e-005 >ref|NP_815246.1| GTP-binding protein [Enterococcus faecalis V583] gb|AAO81316.1| GTP-binding protein [Enterococcus faecalis V583] Length = 438 Score = 59.4 bits (132), Expect = 4e-008 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = +2
+ I+ +S+ + + RP +I+ANKMD+PEA NL FKE++ + + LPIFPI+ Sbjct: 261 LAINKELASHNLRLMERPQIIVANKMDMPEAEENLAKFKEQLAKERTDEYADELPIFPIS 320
T +EP++ A + ++ P FP+ Sbjct: 321 GVTRKGIEPLLNATADLLEVTPEFPL 346 ----------- gnl|ti|818421410 name:POAA-aaa74g09.b1 (401 letters) Score E
Sequences producing significant alignments: (bits) Value ref|XP_420455.1| PREDICTED: similar to D8Ertd354e protein [... 76 5e-013 ref|XP_637852.1| hypothetical protein DDB0186924 [Dictyoste... 71 2e-011 ref|XP_588978.2| PREDICTED: similar to CG6903-PA [Bos taurus] 71 2e-011 emb|CAF93449.1| unnamed protein product [Tetraodon nigrovir... 68 1e-010 ref|XP_539948.2| PREDICTED: similar to CG6903-PA [Canis fam... 68 2e-010 emb|CAH18694.1| hypothetical protein [Homo sapiens] 67 2e-010 dbj|BAB71412.1| unnamed protein product [Homo sapiens] 67 2e-010 ref|XP_519741.1| PREDICTED: similar to hypothetical protein... 67 2e-010 ref|XP_372038.3| PREDICTED: hypothetical protein FLJ32731 [... 67 2e-010 ref|XP_696425.1| PREDICTED: similar to D8Ertd354e protein [... 67 2e-010 >ref|XP_420455.1| PREDICTED: similar to D8Ertd354e protein [Gallus gallus] Length = 571
Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +2
PF W F L L +W +TFLLPVPGCPRGY+GPGG+ D + NCTG Sbjct: 357 PFWPQWIFILMLEVIWLCLTFLLPVPGCPRGYLGPGGIGDFGNYLNCTG 405 --------- gnl|ti|818422015 name:POAA-aaa75a10.g1 (888 letters) Score E
Sequences producing significant alignments: (bits) Value gb|AAK21974.1| rRNA promoter binding protein [Rattus norveg... 71 7e-011 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 46 0.004 ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 46 0.004 dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 43 0.028 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 41 0.091 ref|XP_425688.1| PREDICTED: similar to TGFB-induced factor ... 39 0.29 ref|XP_453843.1| unnamed protein product [Kluyveromyces lac... 38 0.53 emb|CAB52874.1| SPCC830.01c [Schizosaccharomyces pombe] 38 0.53 ref|NP_588472.2| hypothetical protein SPCC1620.14c [Schizos... 38 0.53 ref|XP_453835.1| unnamed protein product [Kluyveromyces lac... 38 0.70 >gb|AAK21974.1| rRNA promoter binding protein [Rattus norvegicus] ref|NP_671477.1| rRNA promoter binding protein [Rattus norvegicus] Length = 295 Score = 71.2 bits (160), Expect = 7e-011 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +1
AS+ A PA L P+ TQP+EPILIPKLRIRLA+FPY PE HLGDLLRI Sbjct: 135 ASSSRGARPAPLRAPARPTQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLGDLLRI 191 ------------ PP22_Resultat gnl|ti|818422017 name:POAA-aaa75a14.g1 mate_pair:818423036 (555 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_635642.1| hypothetical protein DDB0188946 [Dictyoste... 100 3e-020 ref|XP_646988.1| hypothetical protein DDB0216635 [Dictyoste... 90 5e-017 ref|YP_294122.1| putative membrane protein [Emiliania huxle... 87 4e-016 gb|AAD56609.1| putative calmodulin-binding protein CaM-BP46... 86 7e-016 ref|XP_641406.1| hypothetical protein DDB0205868 [Dictyoste... 86 7e-016 ref|XP_636873.1| putative calmodulin-binding protein CaM-BP... 86 7e-016 ref|YP_142990.1| unknown [Acanthamoeba polyphaga mimivirus]... 85 1e-015 ref|XP_637259.1| hypothetical protein DDB0187441 [Dictyoste... 84 2e-015 ref|YP_293958.1| putative membrane protein [Emiliania huxle... 84 2e-015 ref|YP_293946.1| putative membrane protein [Emiliania huxle... 84 3e-015 Yüklə 3,49 Mb. Dostları ilə paylaş:
|