Webmaster's Note: As Gerard says below, his Fourth Report came in two parts



Yüklə 3.49 Mb.
səhifə1/64
tarix04.11.2017
ölçüsü3.49 Mb.
  1   2   3   4   5   6   7   8   9   ...   64

Webmaster's Note: As Gerard says below, his Fourth Report came in two parts. I have incorporated the "Listing of Best Homolog" portion into this file, while the Excel Spreadsheet is accessible via a separate "click" on the main Genome page, following the “click” that got you to this document.
From Gerard: "My fourth report is composed of 2 documents. Actually both were made by my colleague Michel Kress in Villejuif and myself. The first one "List of Physarum traces-hits" is a Microsoft Excel listing of 651 traces of the Physarum pilot assay, showing what we believe are 'significant homologies' to previously known proteins. This was done by comparing the 22,616 translated Physarum reads to the "nr" bank.
The second document "listing of best homolog" shows for each of these reads an alignment corresponding to the best score. This second document is also helpful in obtaining the Ti number of each sequence. Example: You are interested by the PCNA homology of reads #33 of the Excel document. The read identity is POAA-aab24f11. Searching POAA-aab24f11 in the second document gives you access to the "ti" 818415229 code which you can use to get access to the sequence in the trace archive for a closer examination. We did not include the many reads showing homology to reverse transcriptase, integrase and the various polyproteins encoded by repeated retransposon-like sequences that are obviously abundant in the Physarum genome.
The Excel document is presented sorted in alphabetical order of the organism with the closest homolog, to show that Dictyostelium is the closest relative.

*******************************************************************************


Listing of Best Homolog
gnl|ti|820216927 name:POAA-aab46c04.b1

mate_pair:818409684

(914 letters)
Score E

Sequences producing significant alignments: (bits) Value


dbj|BAB33421.1| putative senescence-associated protein [Pis... 70 8e-011

ref|XP_676219.1| conserved hypothetical protein [Plasmodium... 46 0.002

gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 37 1.3

gb|AAZ10060.1| hypothetical protein, conserved [Leishmania ... 36 2.1

ref|XP_414278.1| PREDICTED: similar to PHD finger protein 7... 36 2.1

ref|ZP_00345902.1| hypothetical protein Npun02000359 [Nosto... 34 8.1

>dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum]

Length = 282


Score = 70.5 bits (171), Expect = 8e-011

Identities = 43/77 (55%), Positives = 46/77 (59%)

Frame = +2
Query: 632 SAYTIGLNHWFLSY*SDLLSGHTAAPKRLLVVK*EGKTNLSHDGLNPAHVPFKRVNNPTL 811

SA T N FLSY +LL H GKTNLSHDGL PAHVP+ VNNPTL

Sbjct: 34 SAMTNCANQRFLSYYVELLLRHCHQ---------WGKTNLSHDGLIPAHVPYWWVNNPTL 84
Query: 812 TEFCFSNDRRADIEGIK 862

EFCF+ RADIEG K

Sbjct: 85 GEFCFTMIGRADIEGSK 101

-----------------

gnl|ti|818409684 name:POAA-aab46c04.g1

mate_pair:820216927

(900 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAK21974.1| rRNA promoter binding protein [Rattus norveg... 67 6e-010

ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 67 8e-010

ref|XP_724980.1| hypothetical protein PY04651 [Plasmodium y... 60 8e-008

gb|EAA21327.1| putative senescence-associated protein [Plas... 52 4e-005

ref|XP_767406.1| hypothetical protein GLP_748_1200_211 [Gia... 50 8e-005

gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 44 0.006

dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 43 0.013

pir||A35664 PpoI endonuclease - slime mold (Physarum polyce... 40 0.14

gb|AAB65764.1| endonuclease [Physarum polycephalum] 40 0.14

pir||T02955 probable cytochrome P450 monooxygenase - maize ... 38 0.42

>gb|AAK21974.1| rRNA promoter binding protein [Rattus norvegicus]

ref|NP_671477.1| rRNA promoter binding protein [Rattus norvegicus]

Length = 295
Score = 67.4 bits (163), Expect = 6e-010

Identities = 43/83 (51%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Frame = -2
Query: 509 ASAITKAHPASLTQPS-DTQPIEPILIPKLRIRLAEFPYATLFYAPETAHLGDLLRIRYG 333

AS+ A PA L P+ TQP+EPILIPKLRIRLA+FPY PE HLGDLLRI

Sbjct: 135 ASSSRGARPAPLRAPARPTQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLGDLLRI--W 192
Query: 332 STEGQHVSPICQLF*GNGRRPRT 264

G +P F G R RT

Sbjct: 193 VRPGARFTPSPPDFQGPARAHRT 215

----------

gnl|ti|818409685 name:POAA-aab46c05.g1

mate_pair:820216928

(883 letters)

Score E


Sequences producing significant alignments: (bits) Value
sp|P09353|SR3A_PHYPO Spherulin 3A (S3A) >gi|3114470|pdb|1AG... 58 4e-007

pdb|1HDF|B Chain B, Evolution Of The Eye Lens Beta-Gamma-Cr... 56 1e-006

gb|AAY42820.1| spherulin 3b [Physarum polycephalum] 54 9e-006

emb|CAG01157.1| unnamed protein product [Tetraodon nigrovir... 38 0.41

ref|NP_473177.2| hypothetical protein [Plasmodium falciparu... 34 7.7

ref|YP_003356.1| cytoplasmic membrane protein [Leptospira i... 34 7.7

ref|NP_714491.1| Peptidase family M23/M37 [Leptospira inter... 34 7.7

>sp|P09353|SR3A_PHYPO Spherulin 3A (S3A)

pdb|1AG4| Nmr Structure Of Spherulin 3a (S3a) From Physarum Polycephalum,

Minimized Average Structure

gb|AAA29981.1| spherulin 2b precursor

prf||1402254D spherulin 3a

Length = 103
Score = 58.2 bits (139), Expect = 4e-007

Identities = 30/30 (100%), Positives = 30/30 (100%)

Frame = -2
Query: 423 LEESSQVTDLTTRNLNDAISSIIVATFESA 334

LEESSQVTDLTTRNLNDAISSIIVATFESA

Sbjct: 74 LEESSQVTDLTTRNLNDAISSIIVATFESA 103

-------------

gnl|ti|820216967 name:POAA-aab46g04.b1

mate_pair:818409721

(603 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAO51154.1| similar to Oryza sativa (japonica cultivar-g... 68 2e-010

ref|XP_644233.1| hypothetical protein DDB0217574 [Dictyoste... 68 2e-010

ref|XP_478533.1| putative 1-acyl-sn-glycerol-3-phosphate ac... 65 2e-009

ref|NP_568925.1| acyltransferase [Arabidopsis thaliana] >gi... 62 1e-008

ref|XP_769292.1| hypothetical protein GLP_302_47616_48917 [... 41 0.023

gb|AAQ88467.1| EGAE2753 [Homo sapiens] >gi|16550554|dbj|BAB... 35 1.3

ref|XP_517181.1| PREDICTED: similar to hypothetical protein... 35 1.3

ref|XP_535637.2| PREDICTED: similar to CG3209-PB, isoform B... 35 1.3

dbj|BAD97263.1| hypothetical protein MGC11324 variant [Homo... 35 2.2

gb|AAH97362.1| Hypothetical protein LOC305166 [Rattus norve... 33 4.9

>gb|AAO51154.1| similar to Oryza sativa (japonica cultivar-group). P0681F05.34

protein [Dictyostelium discoideum]

Length = 493
Score = 68.2 bits (165), Expect = 2e-010

Identities = 27/38 (71%), Positives = 30/38 (78%)

Frame = +2
Query: 473 LKDEFTKCFTSNEPEAWNWNIYLYPVWLMGLFLRYCVL 586

L DEF+KCF S E AWNWNIYLYP WL G F+RYC+L

Sbjct: 114 LDDEFSKCFNSPEIHAWNWNIYLYPGWLFGCFIRYCIL 151

Score = 51.2 bits (121), Expect = 2e-005

Identities = 22/37 (59%), Positives = 28/37 (75%)

Frame = +3


Query: 189 VNASSWPIFTPTNSTEADEISKKIEEKLIKQLNEQTN 299

+N W + PTN++E DEISK IEEKL+KQLN+Q N

Sbjct: 56 INQDPWSLLLPTNTSEIDEISKLIEEKLLKQLNKQVN 92

-----------

gnl|ti|818409828 name:POAA-aab47a12.b1

mate_pair:818410148

(869 letters)

Score E


Sequences producing significant alignments: (bits) Value
ref|XP_643268.1| hypothetical protein DDB0169506 [Dictyoste... 66 2e-009

gb|AAU01379.1| MPXV-WRAIR169 [Monkeypox virus] 49 2e-004

gb|AAY97786.1| serine protease inhibitor-like SPI-1 protein... 49 2e-004

gb|AAY97588.1| serine protease inhibitor-like SPI-1 protein... 49 2e-004

gb|AAY97388.1| serine protease inhibitor-like SPI-1 protein... 49 2e-004

gb|AAY97186.1| serine protease inhibitor-like SPI-1 protein... 49 2e-004

gb|AAX09270.1| MPXV-COP-169 [Monkeypox virus] 49 2e-004

ref|XP_645916.1| hypothetical protein DDB0201701 [Dictyoste... 46 0.001

ref|XP_682005.1| hypothetical protein AN8736.2 [Aspergillus... 44 0.006

ref|NP_704458.1| hypothetical protein [Plasmodium falciparu... 42 0.021

>ref|XP_643268.1| hypothetical protein DDB0169506 [Dictyostelium discoideum]

gb|AAS38755.1| similar to Dictyostelium discoideum (Slime mold). MkpA protein

gb|EAL69352.1| hypothetical protein DDB0169506 [Dictyostelium discoideum]

Length = 2473


Score = 65.9 bits (159), Expect = 2e-009

Identities = 56/221 (25%), Positives = 80/221 (36%), Gaps = 4/221 (1%)

Frame = +1
Query: 82 VWVDLQDSVWDTYNGSPVRRGTFATVIRALEEYAAMGITTYV*TSFSYAHNTISFLLDFY 261

VWVDLQDS+WD Y G ++G +I AL+ Y GITT

Sbjct: 1316 VWVDLQDSIWDPYRGEMTKKGRIQNLIDALDHYHQEGITT-------------------- 1355
Query: 262 LF*IA*SRVYLMGALDHRSEDHPFCPTDRATPTKCT*SDVCDTSIVAL*LFMQILAAKKT 441

+Y+MG L+ + P CPTDR D+ + I +F Q++ K

Sbjct: 1356 --------LYVMGLLEKLPSNQPLCPTDR---------DLANRLIGGDQMFSQLVNRAKQ 1398
Query: 442 F*IW*PLQRHGI*NW*SIRLPNWEPVKLTGSIKH----SLVCHKTKRAIRSPLLGMIGTA 609

I++ +L+ H +VCH

Sbjct: 1399 L---------------GIKIVIDSTTRLSSKAAHRKYKGVVCH----------------- 1426
Query: 610 YSPLPTNAASSYAYFFVSVEFEWPECSLLNYRKLATWDLLV 732

L N S S EF W +C +N RKL+ W++ V

Sbjct: 1427 --TLDNNGQLSRLEGTDSSEFTWNDCVSMNMRKLSVWEMFV 1465

Score = 53.1 bits (126), Expect = 1e-005

Identities = 25/59 (42%), Positives = 36/59 (61%)

Frame = +3


Query: 423 LGGEKDFLDLVAAAKARNIKLVVDSTSKLGARKAHRKYKALTCLSQDKKGYTIPAVGND 599

+GG++ F LV AK IK+V+DST++L ++ AHRKYK + C + D G G D

Sbjct: 1383 IGGDQMFSQLVNRAKQLGIKIVIDSTTRLSSKAAHRKYKGVVCHTLDNNGQLSRLEGTD 1441

-------------

gnl|ti|818410148 name:POAA-aab47a12.g1

mate_pair:818409828

(830 letters)

Score E


Sequences producing significant alignments: (bits) Value
ref|XP_643268.1| hypothetical protein DDB0169506 [Dictyoste... 70 1e-010

ref|XP_800514.1| PREDICTED: hypothetical protein XP_795421,... 60 7e-008

ref|XP_799835.1| PREDICTED: hypothetical protein XP_794742 ... 60 7e-008

dbj|BAC87222.1| unnamed protein product [Homo sapiens] 60 9e-008

gb|AAX27955.1| unknown [Schistosoma japonicum] 60 9e-008

ref|XP_800651.1| PREDICTED: hypothetical protein XP_795558 ... 60 9e-008

emb|CAE75230.1| Hypothetical protein CBG23181 [Caenorhabdit... 60 9e-008

ref|XP_331555.1| hypothetical protein [Neurospora crassa] >... 59 2e-007

ref|XP_646781.1| hypothetical protein DDB0191040 [Dictyoste... 59 2e-007

emb|CAE59812.1| Hypothetical protein CBG03276 [Caenorhabdit... 59 2e-007

>ref|XP_643268.1| hypothetical protein DDB0169506 [Dictyostelium discoideum]

gb|AAS38755.1| similar to Dictyostelium discoideum (Slime mold). MkpA protein

gb|EAL69352.1| hypothetical protein DDB0169506 [Dictyostelium discoideum]

Length = 2473


Score = 69.7 bits (169), Expect = 1e-010

Identities = 30/50 (60%), Positives = 36/50 (72%)

Frame = -3
Query: 459 YRVAWHDMVFGFARFLEGEAIIVAINFAHNDADFYVDCSPLAKIFTDDQV 310

+ WHD VFGFARF E I+AINF + D +FYVDCSPLAKI +DD +

Sbjct: 1739 HATGWHDRVFGFARFSGNEVAIIAINFDNTDTEFYVDCSPLAKICSDDTI 1788

-----------

gnl|ti|818410149 name:POAA-aab47b01.g1

mate_pair:818409829

(870 letters)

Score E


Sequences producing significant alignments: (bits) Value
emb|CAA10977.1| threonine deaminase [Arxula adeninivorans] ... 72 2e-011

emb|CAD60619.1| unnamed protein product [Podospora anserina] 67 8e-010

ref|ZP_00565150.1| Threonine dehydratase I [Methylobacillus... 66 1e-009

ref|XP_331226.1| hypothetical protein [Neurospora crassa] >... 66 1e-009

ref|NP_902763.1| threonine dehydratase [Chromobacterium vio... 65 2e-009

gb|EAA69706.1| hypothetical protein FG00296.1 [Gibberella z... 65 3e-009

emb|CAG99933.1| unnamed protein product [Kluyveromyces lact... 64 5e-009

ref|XP_502328.1| hypothetical protein [Yarrowia lipolytica]... 64 5e-009

ref|ZP_00775746.1| Threonine dehydratase I [Pseudoalteromon... 64 5e-009

ref|XP_367299.1| hypothetical protein MG07224.4 [Magnaporth... 64 7e-009

>emb|CAA10977.1| threonine deaminase [Arxula adeninivorans]

sp|O42615|THDH_ARXAD Threonine dehydratase, mitochondrial precursor (Threonine

deaminase)

Length = 550


Score = 72.0 bits (175), Expect = 2e-011

Identities = 31/45 (68%), Positives = 41/45 (91%)

Frame = -3
Query: 634 IGIFADGAAVKLVGEHTFKICKQVVDEVVLVTNDELCAAIKVFFT 500

+G+FADGAAVK++GE TF++C+QVVDE+VLV+ DE+CAAIK FT

Sbjct: 261 VGLFADGAAVKILGEETFRLCQQVVDEIVLVSTDEICAAIKDVFT 305

---------------------

gnl|ti|818410159 name:POAA-aab47b11.g1

mate_pair:818409839

(864 letters)

Score E


Sequences producing significant alignments: (bits) Value
ref|XP_781611.1| PREDICTED: similar to RAB1, member RAS onc... 59 3e-007

emb|CAG13909.1| unnamed protein product [Tetraodon nigrovir... 55 3e-006

dbj|BAD87657.1| Ras-related protein RIC1 [Oryza sativa (jap... 53 1e-005

gb|AAW46571.1| ras-related protein ypt1, putative [Cryptoco... 53 1e-005

ref|NP_957436.1| hypothetical protein LOC394117 [Danio reri... 53 1e-005

ref|NP_001028800.1| GTP binding protein Rab1a [Bos taurus] ... 53 1e-005

ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PROTEIN RI... 53 1e-005

ref|XP_515516.1| PREDICTED: hypothetical protein XP_515516 ... 53 1e-005

ref|NP_914429.1| putative GTP-binding protein [Oryza sativa... 53 1e-005

gb|AAV38334.1| RAB1A, member RAS oncogene family [synthetic... 53 1e-005

>ref|XP_781611.1| PREDICTED: similar to RAB1, member RAS oncogene family

[Strongylocentrotus purpuratus]

Length = 218
Score = 58.5 bits (140), Expect = 3e-007

Identities = 29/34 (85%), Positives = 30/34 (88%)

Frame = -2
Query: 533 PSSDYLFKLLLIGDSGVGKSCLLLRFAVCIPLHS 432

P+SDYLFKLLLIGDSGVGKSCLLLRFAV L S

Sbjct: 3 PNSDYLFKLLLIGDSGVGKSCLLLRFAVISSLFS 36

Score = 38.9 bits (89), Expect = 0.23

Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Frame = -3


Query: 337 LVRFI*CLMIFSCSLILF*-DDTYTESYISTIGVDF 233

L+RF +FS L + DDTYTESYISTIGVDF

Sbjct: 25 LLRFAVISSLFSLFLSFYLQDDTYTESYISTIGVDF 60

>emb|CAG13909.1| unnamed protein product [Tetraodon nigroviridis]

Length = 59
Score = 55.1 bits (131), Expect = 3e-006

Identities = 26/27 (96%), Positives = 26/27 (96%)

Frame = -2
Query: 533 PSSDYLFKLLLIGDSGVGKSCLLLRFA 453

P SDYLFKLLLIGDSGVGKSCLLLRFA

Sbjct: 1 PHSDYLFKLLLIGDSGVGKSCLLLRFA 27

Score = 43.5 bits (101), Expect = 0.009

Identities = 20/24 (83%), Positives = 21/24 (87%)

Frame = -3


Query: 304 SCSLILF*DDTYTESYISTIGVDF 233

SC L+ F DDTYTESYISTIGVDF

Sbjct: 20 SCLLLRFADDTYTESYISTIGVDF 43

-------------

gnl|ti|818409842 name:POAA-aab47c03.b1

mate_pair:818410161

(915 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAX30301.1| unknown [Schistosoma japonicum] 87 8e-016

emb|CAH00945.1| unnamed protein product [Kluyveromyces lact... 86 2e-015

dbj|BAD26579.1| cytochrome P450 like_TBP [Citrullus lanatus] 74 5e-012

gb|AAX27748.1| unknown [Schistosoma japonicum] 69 3e-010

pir||T02955 probable cytochrome P450 monooxygenase - maize ... 66 2e-009

emb|CAB51041.1| putative transcription factor [Periplaneta ... 65 3e-009

ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 65 3e-009

dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 63 1e-008

gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 54 6e-006

gb|EAA21327.1| putative senescence-associated protein [Plas... 47 7e-004

>gb|AAX30301.1| unknown [Schistosoma japonicum]

Length = 55


Score = 87.0 bits (214), Expect = 8e-016

Identities = 40/44 (90%), Positives = 41/44 (93%)

Frame = +2
Query: 629 LICDAHEWINEIPTVPTYYLAKPQPRERAWHN*RGKKTLLSLTL 760

LI DAHEW+NEIPTVPTYYLAKPQPRERAW N RGKKTLLSLTL

Sbjct: 5 LISDAHEWMNEIPTVPTYYLAKPQPRERAWRNQRGKKTLLSLTL 48

----------

gnl|ti|818410192 name:POAA-aab47f04.g1

(902 letters)


Score E


Sequences producing significant alignments: (bits) Value
gb|AAF56326.1| CG13628-PA [Drosophila melanogaster] >gi|546... 60 1e-007

gb|ABA91866.1| dna-directed rna polymerase ii 8.2 kda polyp... 59 2e-007

gb|EAA00426.2| ENSANGP00000020255 [Anopheles gambiae str. P... 59 2e-007

ref|NP_176363.1| DNA-directed RNA polymerase [Arabidopsis t... 59 2e-007

ref|XP_577644.1| PREDICTED: similar to Ab1-108 [Rattus norv... 59 2e-007

gb|AAP92539.1| Ab1-108 [Rattus norvegicus] 59 3e-007

ref|NP_001016343.1| hypothetical protein LOC549097 [Xenopus... 59 3e-007

ref|XP_874715.1| PREDICTED: similar to DNA-directed RNA pol... 59 3e-007

ref|XP_521707.1| PREDICTED: similar to Ab1-108 [Pan troglod... 59 3e-007

ref|XP_697922.1| PREDICTED: similar to DNA-directed RNA pol... 59 3e-007

>gb|AAF56326.1| CG13628-PA [Drosophila melanogaster]

gb|EAL26851.1| GA12420-PA [Drosophila pseudoobscura]

gb|AAM51044.1| SD08670p [Drosophila melanogaster]

sp|Q9VC49|RPB10_DROME DNA-directed RNA polymerase II 7.6 kDa polypeptide (RPB10) (RPB7.6)

ref|NP_651280.1| CG13628-PA [Drosophila melanogaster]

Length = 67


Score = 59.7 bits (143), Expect = 1e-007

Identities = 24/27 (88%), Positives = 27/27 (100%)

Frame = +1
Query: 337 RCFTCGKVIGNKWDTYLGLLQADYTEG 417

RCFTCGKVIGNKW++YLGLLQA+YTEG

Sbjct: 6 RCFTCGKVIGNKWESYLGLLQAEYTEG 32

---------

gnl|ti|818409881 name:POAA-aab47g01.b1

mate_pair:818410200

(900 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAG41774.1| Cat [Promoter probe vector pPR9TT] 466 e-130

gb|ABB17069.1| chloramphenicol acetyl transferase [Moss gen... 465 e-129

-------------

gnl|ti|818410200 name:POAA-aab47g01.g1

mate_pair:818409881

(884 letters)


Score E


Sequences producing significant alignments: (bits) Value
sp|P03851|YPB3_ECOLI Hypothetical 9.4 kDa protein 179 1e-043

gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] >gi|9507257|ref|... 122 1e-026

pir||JQ1541 hypothetical 16.9K protein - Salmonella typhimu... 118 3e-025

gb|AAR02632.1| conserved hypothetical protein [Salmonella t... 93 1e-017

ref|YP_355421.1| hypothetical protein pCollet_06 [Escherich... 90 9e-017

ref|NP_758764.1| hypothetical protein pEA28_01 [Erwinia amy... 90 1e-016

gb|AAB59125.1| 13.8 kd ORF [Plasmid ColE1] >gi|9507258|ref|... 89 2e-016

ref|ZP_00374729.1| conserved hypothetical protein [Wolbachi... 81 5e-014

ref|NP_995570.1| hypothetical protein pPCP04 [Yersinia pest... 74 7e-012

sp|P03845|YPA1_ECOLI Hypothetical protein 1 72 3e-011

>sp|P03851|YPB3_ECOLI Hypothetical 9.4 kDa protein

Length = 84


Score = 179 bits (453), Expect = 1e-043

Identities = 83/84 (98%), Positives = 84/84 (100%)

Frame = -3
Query: 540 VHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGY 361

+HEPPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGY

Sbjct: 1 MHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGY 60
Query: 360 TRRTVFGICALLKPVTFGKRVGSS 289

TRRTVFGICALLKPVTFGKRVGSS

Sbjct: 61 TRRTVFGICALLKPVTFGKRVGSS 84

-----


gnl|ti|818410208 name:POAA-aab47g10.g1

mate_pair:818409889

(903 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAG22284.1| CG12352-PA [Drosophila melanogaster] >gi|179... 65 4e-009

dbj|BAD52531.1| Mak3 protein-like protein [Oryza sativa (ja... 64 6e-009

gb|EAL26071.1| GA11576-PA [Drosophila pseudoobscura] 64 7e-009

ref|NP_196695.1| N-acetyltransferase [Arabidopsis thaliana]... 64 9e-009

gb|AAH78316.1| Mak3 homolog [Danio rerio] >gi|57525643|ref|... 64 9e-009

emb|CAG04228.1| unnamed protein product [Tetraodon nigrovir... 63 2e-008

ref|XP_595378.1| PREDICTED: similar to Mak3 homolog, partia... 62 3e-008

ref|XP_526267.1| PREDICTED: similar to Mak3 homolog [Pan tr... 62 3e-008

dbj|BAE40319.1| unnamed protein product [Mus musculus] 62 3e-008

dbj|BAE39286.1| unnamed protein product [Mus musculus] 62 3e-008

>gb|AAG22284.1| CG12352-PA [Drosophila melanogaster]

gb|AAL48448.1| AT27602p [Drosophila melanogaster]

gb|AAF34715.1| separation anxiety protein [Drosophila melanogaster]

sp|Q9NHD5|SAN_DROME Probable acetyltransferase san (Separation anxiety protein)

ref|NP_524779.1| CG12352-PA [Drosophila melanogaster]

Length = 184


Score = 64.7 bits (156), Expect = 4e-009

Identities = 44/115 (38%), Positives = 55/115 (47%), Gaps = 3/115 (2%)

Frame = -2
Query: 869 YNDKFYNGPVTSRKRGNFTKLGYDVSLNTSLNFSLNCCD*LYYNDIFVGAVCCRV---EE 699

YNDKFY V + G KL Y YNDI VGAVCCR+ E

Sbjct: 31 YNDKFY---VDVLEAGELAKLAY-------------------YNDIVVGAVCCRIDNTEN 68
Query: 698 EHKVYIMTLGVLAPYRQLKIGMFLFTQSQTDTDLDVHVFI*IGATHSLFKHVIIS 534

+ ++YIMTLG L+PYR+L IG +F + D G S+F HV I+

Sbjct: 69 QRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKD-------GNFDSIFLHVQIN 116

Score = 60.5 bits (145), Expect = 8e-008

Identities = 40/115 (34%), Positives = 53/115 (46%)

Frame = -3


Query: 469 GTELLEYVINLCKKHPQVQQIYPAMVFFLDFKTY*LTVSTYLHVQVNNDAAIEFYKRFGF 290

GT + E+++N +K I+ LHVQ+NN+ AIEFYK+FGF

Sbjct: 89 GTVMFEHIMNFAEKDGNFDSIF-------------------LHVQINNNGAIEFYKKFGF 129
Query: 289 EITETIQNYCIHSNSHQRFIIFQINFSFIRVDKRIEPPDCYVLLKTLTKDPTAPN 125

EI +T + Y KRIEP D +VL KTL + TAPN

Sbjct: 130 EIVDTKEQYY----------------------KRIEPADAHVLQKTLRR--TAPN 160

------------------

gnl|ti|818410210 name:POAA-aab47g12.g1

mate_pair:818409891

(756 letters)

Score E


Sequences producing significant alignments: (bits) Value
gb|AAL31950.1| CDH1-D [Gallus gallus] 85 2e-015

ref|XP_428325.1| PREDICTED: similar to Ac1147, partial [Gal... 62 2e-008

gb|AAP92584.1| Ab2-057 [Rattus norvegicus] >gi|32492570|gb|... 57 5e-007

ref|XP_520857.1| PREDICTED: hypothetical protein XP_520857 ... 57 5e-007

ref|XP_358030.2| PREDICTED: similar to Ac1147 [Mus musculus] 57 8e-007

ref|XP_578848.1| PREDICTED: similar to Ac1147 [Rattus norve... 43 0.010

ref|XP_578845.1| PREDICTED: similar to Ac1147 [Rattus norve... 43 0.010

ref|XP_578905.1| PREDICTED: similar to Ac1147 [Rattus norve... 41 0.048

ref|XP_578906.1| PREDICTED: similar to Ac1147 [Rattus norve... 39 0.14

ref|XP_578847.1| PREDICTED: similar to Ac1147 [Rattus norve... 39 0.14

>gb|AAL31950.1| CDH1-D [Gallus gallus]

Length = 451


Score = 85.1 bits (209), Expect = 2e-015

Identities = 61/132 (46%), Positives = 71/132 (53%), Gaps = 1/132 (0%)

Frame = +1
Query: 124 NDPNAGSPTITLLRLLLPLGRTVVRTLADAPEPVKTRKHRPPNA*L*NPIGSTDGRCVQR 303

NDP+AGSPT TLLRLLLPL V + + V P L +PIGS+DGRCVQR

Sbjct: 250 NDPSAGSPTETLLRLLLPLDSQVRPSSRRSGRAVADPAGADPRTSLNHPIGSSDGRCVQR 309
Query: 304 AGTHSTQVNDLRLLKIPRLRPIIAKICPSQS-RD*GLPRPFGRGTPCSSTRFTCHCNARA 480

AGT+ST+ D LL IPR IIA P G PR +GT S C+ R

Sbjct: 310 AGTYSTRAYDPHLLGIPRSWGIIAIPDPHHEWGSTGYPRLPAKGTHKLSQSVQRACSPRT 369
Query: 481 AQNI*GHD*PVI 516



Dostları ilə paylaş:
  1   2   3   4   5   6   7   8   9   ...   64


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©muhaz.org 2017
rəhbərliyinə müraciət

    Ana səhifə