Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
|
++F K
Sbjct: 857 CQPNNFNK 864 ------------------- gnl|ti|818418996 name:POAA-aaa42e01.g1 (796 letters) Score E
Sequences producing significant alignments: (bits) Value ref|XP_420227.1| PREDICTED: similar to RIKEN cDNA 6330505F0... 74 6e-012 ref|XP_417071.1| PREDICTED: similar to DEAD/H (Asp-Glu-Ala-... 72 3e-011 emb|CAI40723.1| DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptid... 71 4e-011 emb|CAI56763.1| hypothetical protein [Homo sapiens] 71 4e-011 ref|NP_001016198.1| hypothetical protein LOC548952 [Xenopus... 71 4e-011 ref|XP_521277.1| PREDICTED: hypothetical protein XP_521277 ... 71 4e-011 ref|NP_766367.1| hypothetical protein LOC236790 [Mus muscul... 71 4e-011 ref|NP_872346.2| hypothetical protein LOC203522 [Homo sapiens] 71 4e-011 ref|XP_866217.1| PREDICTED: similar to DEAD/H (Asp-Glu-Ala-... 71 4e-011 gb|AAH51161.1| 6330505F04Rik protein [Mus musculus] >gi|263... 71 4e-011 >ref|XP_420227.1| PREDICTED: similar to RIKEN cDNA 6330505F04 [Gallus gallus] Length = 981
Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -3
PPRT HP +R++ V EP+V+D PFDKYELEP PLT ++L+ + T WQVFV+G Sbjct: 460 PPRTAHPVVRFSCVDCEPMVIDKLPFDKYELEPSPLTQYILERKS--PHTCWQVFVSG 515 ------------------ PP12_Resultat
mate_pair:820220157 (381 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAS50683.1| ABL088Cp [Ashbya gossypii ATCC 10895] >gi|45... 48 1e-004 emb|CAD70981.1| probable serine-tRNA ligase, cytosolic [Neu... 47 2e-004 ref|XP_327882.1| hypothetical protein [Neurospora crassa] >... 47 2e-004 gb|EAL92043.1| seryl-tRNA synthetase [Aspergillus fumigatus... 46 4e-004 ref|XP_451464.1| unnamed protein product [Kluyveromyces lac... 46 5e-004 ref|XP_719967.1| putative serine tRNA synthetase [Candida a... 46 5e-004 ref|XP_720099.1| putative serine tRNA synthetase [Candida a... 46 5e-004 ref|XP_644993.1| serine-tRNA ligase [Dictyostelium discoide... 46 5e-004 ref|XP_793542.1| PREDICTED: similar to seryl-aminoacyl-tRNA... 45 6e-004 emb|CAJ02371.1| seryl-tRNA synthetase, putative [Leishmania... 45 8e-004 >gb|AAS50683.1| ABL088Cp [Ashbya gossypii ATCC 10895] ref|NP_982859.1| ABL088Cp [Eremothecium gossypii] Length = 459
Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +1
+ N E QSLGIPYR+V IVSG LNNAAAKKY Sbjct: 320 IANSEEFYQSLGIPYRIVGIVSGELNNAAAKKY 352 ------------- gnl|ti|818419016 name:POAA-aaa42g23.g1 mate_pair:820220158 (718 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] >gi|9507257|ref|... 150 5e-035 --------- gnl|ti|818416839 name:POAA-aaa43a10.g1 mate_pair:820221172 (898 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAB33421.1| putative senescence-associated protein [Pis... 69 2e-010 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 69 3e-010 ref|XP_577589.1| PREDICTED: similar to LRRG00134 [Rattus no... 64 9e-009 ref|XP_648070.1| conserved hypothetical protein [Entamoeba ... 56 1e-006 gb|AAR25995.1| putative senescence-associated protein [Pyru... 54 1e-005 ref|XP_665229.1| senescence-associated protein [Cryptospori... 47 7e-004 ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 47 0.001 gb|EAA18798.1| hypothetical protein [Plasmodium yoelii yoelii] 46 0.002 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 45 0.004 gb|EAA21327.1| putative senescence-associated protein [Plas... 44 0.010 >dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 69.3 bits (168), Expect = 2e-010 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2
VNNPTL EFCF+MIGRADIEGSKS+VAMNAW PQAS Sbjct: 79 VNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQAS 114 Score = 35.8 bits (81), Expect = 2.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +3 Query: 144 GKTNLSHDGLNPAHVP 191 GKTNLSHDGL PAHVP Sbjct: 60 GKTNLSHDGLIPAHVP 75 ------------------- gnl|ti|820221193 name:POAA-aaa43e10.b1 mate_pair:818416858 (358 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|ZP_00732312.1| dehydrogenases with different specificit... 53 3e-006 gb|AAU38770.1| FabG protein [Mannheimia succiniciproducens ... 50 2e-005 gb|AAM46847.1| steroleosin-B [Sesamum indicum] 49 5e-005 ref|NP_190319.1| oxidoreductase [Arabidopsis thaliana] >gi|... 46 4e-004 dbj|BAB66142.1| 250aa long hypothetical 3-oxoacyl-[acyl-car... 46 5e-004 gb|EAA01650.2| ENSANGP00000009713 [Anopheles gambiae str. P... 46 5e-004 ref|ZP_00398867.1| Short-chain dehydrogenase/reductase SDR ... 45 6e-004 emb|CAD16028.1| PROBABLE DEHYDROGENASE/REDUCTASE OXIDOREDUC... 45 6e-004 ref|XP_785686.1| PREDICTED: similar to Dehydrogenase/reduct... 45 6e-004 ref|XP_790920.1| PREDICTED: similar to Dehydrogenase/reduct... 45 6e-004 >ref|ZP_00732312.1| dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Actinobacillus succinogenes 130Z] gb|EAO50604.1| dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Actinobacillus succinogenes 130Z]
Length = 249 Score = 53.1 bits (126), Expect = 3e-006 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1
NN V K++IITGASSGIG+ AY+LAE+GA L+LG Sbjct: 2 NNIVNKIVIITGASSGIGEATAYKLAEQGAKLVLG 36 -------------------- gnl|ti|820221215 name:POAA-aaa43k08.b1 mate_pair:818416879 (517 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAJ00344.1| chloramphenicol acetyltransferase [Aeromona... 115 8e-025 --------- gnl|ti|820221223 name:POAA-aaa43m06.b1 mate_pair:818416889 (677 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|ZP_00460071.1| Glucose-methanol-choline oxidoreductase:... 77 6e-013 ref|NP_104253.1| dehydrogenase, (L-sorbose dehydrogenase, G... 76 1e-012 ref|ZP_00375636.1| putative alcohol dehydrogenase [Erythrob... 73 7e-012 ref|YP_222680.1| L-sorbose dehydrogenase, FAD dependent, hy... 73 9e-012 gb|AAN30932.1| L-sorbose dehydrogenase, FAD dependent, puta... 70 6e-011 ref|YP_270109.1| oxidoreductase, GMC family [Colwellia psyc... 70 8e-011 ref|ZP_00654089.1| Glucose-methanol-choline oxidoreductase:... 70 8e-011 ref|YP_264896.1| glucose-methanol-choline oxidoreductase:GM... 69 1e-010 ref|ZP_00846340.1| Glucose-methanol-choline oxidoreductase:... 69 1e-010 ref|ZP_00632566.1| Glucose-methanol-choline oxidoreductase:... 69 1e-010 >ref|ZP_00460071.1| Glucose-methanol-choline oxidoreductase:GMC oxidoreductase [Burkholderia cenocepacia HI2424] ref|ZP_00456417.1| Glucose-methanol-choline oxidoreductase:GMC oxidoreductase [Burkholderia cenocepacia AU 1054] gb|EAM20887.1| Glucose-methanol-choline oxidoreductase:GMC oxidoreductase [Burkholderia cenocepacia HI2424] gb|EAM10820.1| Glucose-methanol-choline oxidoreductase:GMC oxidoreductase [Burkholderia cenocepacia AU 1054] Length = 587 Score = 76.6 bits (187), Expect = 6e-013 Identities = 37/64 (57%), Positives = 43/64 (67%) Frame = -1
GG S NAM+Y RG D+ WRD G GWGFDDVLPYFK+ E+NE N DVHG GP Sbjct: 121 GGGSSVNAMIYIRGVPSDYDQWRDS-GATGWGFDDVLPYFKRSEDNERFCN-DVHGTGGP 178
+ +S
Sbjct: 179 LRVS 182 ------------ gnl|ti|820220060 name:POAA-aaa44b05.b1 mate_pair:818418900 (875 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_642309.1| Rab GTPase [Dictyostelium discoideum] >gi|... 53 1e-005 ref|XP_419342.1| PREDICTED: similar to ras-related protein ... 53 1e-005 ref|XP_781611.1| PREDICTED: similar to RAB1, member RAS onc... 53 1e-005 gb|AAP86259.1| Ac2-048 [Rattus norvegicus] 53 1e-005 gb|AAX69377.1| small GTP-binding protein Rab1, putative [Tr... 52 3e-005 ref|XP_807614.1| small GTP-binding protein Rab1 [Trypanosom... 52 3e-005 gb|AAP06156.1| similar to NM_070996 RAS-related protein in ... 50 1e-004 ref|XP_877466.1| PREDICTED: similar to RAB1, member RAS onc... 49 2e-004 ref|XP_865926.1| PREDICTED: similar to RAB1B, member RAS on... 47 7e-004 emb|CAG13909.1| unnamed protein product [Tetraodon nigrovir... 45 0.003 >ref|XP_642309.1| Rab GTPase [Dictyostelium discoideum] gb|EAL68106.1| Rab GTPase [Dictyostelium discoideum] Length = 206 Score = 53.1 bits (126), Expect = 1e-005 Identities = 29/63 (46%), Positives = 34/63 (53%) Frame = -1
K+Q+WDTAGQERFRTITS SYYRGAHG V++D+TD Sbjct: 58 KLQIWDTAGQERFRTITS-------------------------SYYRGAHGIIVVYDVTD 92
S Sbjct: 93 HVS 95 Score = 48.9 bits (115), Expect = 2e-004 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = -3
D ++ESYISTIGVDFKIRT+N+DG ++K+ Sbjct: 30 DDTYTESYISTIGVDFKIRTINLDGKIIKL 59 Score = 43.9 bits (102), Expect = 0.007 Identities = 18/24 (75%), Positives = 24/24 (100%) Frame = -2 Query: 667 DFLFKIVLIGNSGVGKSCIVLRFA 596 D+LFK++LIG+SGVGKSC++LRFA Sbjct: 6 DYLFKLLLIGDSGVGKSCLLLRFA 29 ---------- gnl|ti|818418900 name:POAA-aaa44b05.g1 mate_pair:820220060 (867 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_645485.1| SMAD/FHA domain-containing protein [Dictyo... 76 1e-012 ref|NP_187314.1| ATP binding / kinase/ protein kinase/ prot... 62 3e-008 ref|NP_199758.2| ATP binding / kinase/ protein kinase/ prot... 59 2e-007 ref|YP_143180.1| serine/threonine protein kinase [Acanthamo... 58 4e-007 ref|XP_655583.1| protein kinase, putative [Entamoeba histol... 58 5e-007 ref|XP_649425.1| protein kinase, putative [Entamoeba histol... 57 8e-007 ref|XP_636072.1| putative tyrosine kinase-like protein [Dic... 55 4e-006 ref|YP_143185.1| serine/threonine protein kinase [Acanthamo... 53 2e-005 ref|XP_636073.1| putative tyrosine kinase-like protein [Dic... 53 2e-005 ref|YP_143172.1| unknown [Acanthamoeba polyphaga mimivirus]... 52 3e-005 >ref|XP_645485.1| SMAD/FHA domain-containing protein [Dictyostelium discoideum] gb|AAO52624.2| similar to Dictyostelium discoideum (Slime mold). Protein tyrosine kinase
gb|EAL71531.1| putative tyrosine kinase-like (TKL) protein [Dictyostelium discoideum] Length = 1024
Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3
K+ ID A GMNYLHTYSPPIIHRDLKS+NLLVD+NFNVKVS Sbjct: 461 KMLIDVAQGMNYLHTYSPPIIHRDLKSLNLLVDNNFNVKVS 501 Score = 65.9 bits (159), Expect = 2e-009 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -2 Query: 281 FFFKVSDFGLARFTVKNI--KATTFCGTLQWIAPELLSGVGYTTQVDVYRYNL 129 F KVSDFGL+RF I A TFCGTL WIAPE+ +G GYTT+VDVY + + Sbjct: 496 FNVKVSDFGLSRFISGGIGSSAKTFCGTLSWIAPEVFNGSGYTTKVDVYSFGI 548 Score = 40.8 bits (94), Expect = 0.061 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = -1 Query: 756 FGK*IDFFLCLMYSFYFL*LL*GTCIQEKDMAIVTEFMSRGSLRDVLNT 610 F K + CL + L + GTC+ ++AI+TE+++RGSLRDVL T Sbjct: 402 FEKEVSILKCLRHPNVVLFM--GTCLLNGNLAIITEYLNRGSLRDVLTT 448 ------------- gnl|ti|818418901 name:POAA-aaa44b09.g1 mate_pair:820220062 (876 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_645485.1| SMAD/FHA domain-containing protein [Dictyo... 76 1e-012 ref|NP_187314.1| ATP binding / kinase/ protein kinase/ prot... 62 3e-008 ref|NP_199758.2| ATP binding / kinase/ protein kinase/ prot... 59 2e-007 ref|YP_143180.1| serine/threonine protein kinase [Acanthamo... 58 4e-007 ref|XP_655583.1| protein kinase, putative [Entamoeba histol... 58 5e-007 ref|XP_649425.1| protein kinase, putative [Entamoeba histol... 57 8e-007 ref|XP_636072.1| putative tyrosine kinase-like protein [Dic... 55 4e-006 ref|YP_143185.1| serine/threonine protein kinase [Acanthamo... 53 2e-005 ref|XP_636073.1| putative tyrosine kinase-like protein [Dic... 53 2e-005 ref|YP_143172.1| unknown [Acanthamoeba polyphaga mimivirus]... 52 3e-005 >ref|XP_645485.1| SMAD/FHA domain-containing protein [Dictyostelium discoideum] gb|AAO52624.2| similar to Dictyostelium discoideum (Slime mold). Protein tyrosine kinase
gb|EAL71531.1| putative tyrosine kinase-like (TKL) protein [Dictyostelium discoideum] Length = 1024
Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3
K+ ID A GMNYLHTYSPPIIHRDLKS+NLLVD+NFNVKVS Sbjct: 461 KMLIDVAQGMNYLHTYSPPIIHRDLKSLNLLVDNNFNVKVS 501 Score = 65.9 bits (159), Expect = 2e-009 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -2 Query: 281 FFFKVSDFGLARFTVKNI--KATTFCGTLQWIAPELLSGVGYTTQVDVYRYNL 129 F KVSDFGL+RF I A TFCGTL WIAPE+ +G GYTT+VDVY + + Sbjct: 496 FNVKVSDFGLSRFISGGIGSSAKTFCGTLSWIAPEVFNGSGYTTKVDVYSFGI 548 Score = 41.2 bits (95), Expect = 0.047 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = -1 Query: 732 LFACTRFYFL*LL*GTCIQEKDMAIVTEFMSRGSLRDVLNT 610 + C R + L GTC+ ++AI+TE+++RGSLRDVL T Sbjct: 408 ILKCLRHPNVVLFMGTCLLNGNLAIITEYLNRGSLRDVLTT 448 ----------------- gnl|ti|818418915 name:POAA-aaa44d19.g1 mate_pair:820220076 (922 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAO51241.1| similar to Dictyostelium discoideum (Slime m... 141 3e-032 ref|XP_642749.1| AP-2 medium chain [Dictyostelium discoideu... 141 3e-032 sp|P54672|AP50_DICDI Clathrin coat assembly protein AP50 (C... 139 1e-031 gb|AAW41812.1| intracellular protein transport-related prot... 103 1e-020 ref|XP_759291.1| hypothetical protein UM03144.1 [Ustilago m... 101 4e-020 emb|CAD70739.1| probable clathrin-associated adaptor comple... 100 7e-020 gb|EAL91805.1| AP-2 adaptor complex subunit mu, putative [A... 99 2e-019 gb|EAA69736.1| conserved hypothetical protein [Gibberella z... 99 2e-019 ref|XP_360109.1| hypothetical protein MG05484.4 [Magnaporth... 98 4e-019 gb|AAX07648.1| clathrin coat assembly protein-like protein ... 98 4e-019 >gb|AAO51241.1| similar to Dictyostelium discoideum (Slime mold). Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) Length = 444
Identities = 76/122 (62%), Positives = 87/122 (71%), Gaps = 8/122 (6%) Frame = -1
K DKI+KITIQATG PWR PDIK+++NE+Y IDVVESVNLLMS Sbjct: 151 KQDKISKITIQATGTTPWRTPDIKYKRNELY----------------IDVVESVNLLMSA 194
+ N+LRADVSGQVMMKC LSGMPECKFGMNDKV++D+E +R GA RR NGIE Sbjct: 195 EGNILRADVSGQVMMKCFLSGMPECKFGMNDKVIMDREKSTNGGSAARSGA--RRANGIE 252
ID Sbjct: 253 ID 254 Score = 65.9 bits (159), Expect = 2e-009 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2
DITFHQCV+L KFD+DR +SF+PPDGEFELM+Y T Sbjct: 255 DITFHQCVRLGKFDSDRTVSFIPPDGEFELMRYRT 289 ------------ gnl|ti|820220084 name:POAA-aaa44f19.b1 mate_pair:818418925 (523 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAA62506.1| AgTHR4 [Eremothecium gossypii] >gi|44980491... 71 2e-011 gb|EAL92680.1| threonine synthase [Aspergillus fumigatus Af... 70 2e-011 gb|EAN27677.1| Threonine synthase [Magnetococcus sp. MC-1] ... 70 3e-011 emb|CAG37348.1| probable threonine synthase [Desulfotalea p... 69 7e-011 gb|AAU09679.1| YCR053W [Saccharomyces cerevisiae] 68 1e-010 ref|NP_009982.1| Threonine synthase, conserved protein that... 68 1e-010 pdb|1KL7|B Chain B, Crystal Structure Of Threonine Synthase... 68 1e-010 ref|XP_448625.1| unnamed protein product [Candida glabrata]... 68 2e-010 ref|ZP_00551855.1| Threonine synthase [Desulfuromonas aceto... 68 2e-010 gb|AAR35073.1| threonine synthase [Geobacter sulfurreducens... 68 2e-010 >emb|CAA62506.1| AgTHR4 [Eremothecium gossypii] gb|AAS50424.1| AAR059Cp [Ashbya gossypii ATCC 10895] ref|NP_982600.1| AAR059Cp [Eremothecium gossypii] sp|Q00063|THRC_ASHGO Threonine synthase (TS) Length = 512 Score = 70.9 bits (172), Expect = 2e-011 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 8/52 (15%) Frame = -1
NL ILELFHGPT++FKDVALQF+GNLFEY LE+ +++H+TVVGAT Sbjct: 106 NLHILELFHGPTYAFKDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGAT 157 ----------- gnl|ti|818418925 name:POAA-aaa44f19.g1 mate_pair:820220084 (322 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|EAN27677.1| Threonine synthase [Magnetococcus sp. MC-1] ... 47 3e-004 emb|CAG37348.1| probable threonine synthase [Desulfotalea p... 46 5e-004 gb|AAR35073.1| threonine synthase [Geobacter sulfurreducens... 45 8e-004 ref|ZP_00551855.1| Threonine synthase [Desulfuromonas aceto... 42 0.007 ref|YP_285588.1| Threonine synthase [Dechloromonas aromatic... 42 0.009 ref|YP_356918.1| threonine synthase [Pelobacter carbinolicu... 41 0.015 ref|ZP_00669895.1| Threonine synthase [Nitrosomonas eutroph... 40 0.020 ref|YP_384587.1| Threonine synthase [Geobacter metallireduc... 40 0.026 ref|YP_159845.1| threonine synthase [Azoarcus sp. EbN1] >gi... 39 0.044 ref|NP_842365.1| thrC; probable threonine synthase protein ... 39 0.044 >gb|EAN27677.1| Threonine synthase [Magnetococcus sp. MC-1] ref|ZP_00607908.1| Threonine synthase [Magnetococcus sp. MC-1] Length = 459 Score = 46.6 bits (109), Expect = 3e-004 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = -1
F P L+ KDVA+Q+LGN+F+Y+ EKQ +N++GA Sbjct: 103 FHGPTLAFKDVALQFLGNLFEYLLEKQGGRLNIIGA 138 --------------------- gnl|ti|820220086 name:POAA-aaa44h03.b1 mate_pair:818418928 (523 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAA62506.1| AgTHR4 [Eremothecium gossypii] >gi|44980491... 71 2e-011 gb|EAL92680.1| threonine synthase [Aspergillus fumigatus Af... 70 2e-011 gb|EAN27677.1| Threonine synthase [Magnetococcus sp. MC-1] ... 70 3e-011 emb|CAG37348.1| probable threonine synthase [Desulfotalea p... 69 7e-011 gb|AAU09679.1| YCR053W [Saccharomyces cerevisiae] 68 1e-010 ref|NP_009982.1| Threonine synthase, conserved protein that... 68 1e-010 pdb|1KL7|B Chain B, Crystal Structure Of Threonine Synthase... 68 1e-010 ref|XP_448625.1| unnamed protein product [Candida glabrata]... 68 2e-010 ref|ZP_00551855.1| Threonine synthase [Desulfuromonas aceto... 68 2e-010 gb|AAR35073.1| threonine synthase [Geobacter sulfurreducens... 68 2e-010 >emb|CAA62506.1| AgTHR4 [Eremothecium gossypii] gb|AAS50424.1| AAR059Cp [Ashbya gossypii ATCC 10895] ref|NP_982600.1| AAR059Cp [Eremothecium gossypii] sp|Q00063|THRC_ASHGO Threonine synthase (TS) Length = 512 Score = 70.9 bits (172), Expect = 2e-011 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 8/52 (15%) Frame = -2
NL ILELFHGPT++FKDVALQF+GNLFEY LE+ +++H+TVVGAT Sbjct: 106 NLHILELFHGPTYAFKDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGAT 157 --------
gnl|ti|818418949 name:POAA-aaa44l07.g1 mate_pair:820220101 (479 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAQ97750.1| chromosome 2 open reading frame 6 [Danio rerio] 58 1e-007 ref|NP_999948.2| Mob4B protein [Danio rerio] >gi|63102471|g... 58 1e-007 gb|AAY41047.1| unknown [Homo sapiens] 58 1e-007 gb|AAT66503.1| kinase regulatory subunit MOB1B [Xenopus lae... 58 1e-007 gb|AAH63989.1| MOB1, Mps One Binder kinase activator-like 1... 58 1e-007 ref|NP_081011.1| MOB1, Mps One Binder kinase activator-like... 58 1e-007 ref|XP_420601.1| PREDICTED: similar to MOB1, Mps One Binder... 58 1e-007 emb|CAA22288.1| SPBC428.13c [Schizosaccharomyces pombe] >gi... 58 1e-007 ref|XP_341195.2| PREDICTED: similar to Mps one binder kinas... 58 1e-007 emb|CAF97101.1| unnamed protein product [Tetraodon nigrovir... 58 1e-007 >gb|AAQ97750.1| chromosome 2 open reading frame 6 [Danio rerio] Length = 216
Identities = 20/42 (47%), Positives = 32/42 (76%) Frame = +1
G+D+NEW+A+NT++ + +N+ YG + DFCS+ SCP +S P Sbjct: 50 GEDLNEWVAVNTVDFFNQINMLYGTITDFCSEDSCPVMSAGP 91 ------------- gnl|ti|818418955 name:POAA-aaa44l23.g1 mate_pair:820220107 (894 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 68 4e-010 gb|AAK21974.1| rRNA promoter binding protein [Rattus norveg... 67 6e-010 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 60 8e-008 gb|EAA21327.1| putative senescence-associated protein [Plas... 52 4e-005 ref|XP_767406.1| hypothetical protein GLP_748_1200_211 [Gia... 50 8e-005 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 44 0.006 dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 43 0.013 pir||A35664 PpoI endonuclease - slime mold (Physarum polyce... 40 0.14 Yüklə 3,49 Mb. Dostları ilə paylaş:
|