Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
|
ref|XP_374627.2| PREDICTED: similar to Guanine nucleotide-b... 63 1e-008 >ref|XP_639105.1| G-protein subunit alpha 1 [Dictyostelium discoideum] sp|P16894|GPA1_DICDI Guanine nucleotide-binding protein alpha-1 subunit (G alpha 1) gb|EAL65751.1| G-protein subunit alpha 1 [Dictyostelium discoideum] gb|AAA33207.1| G protein alpha-subunit 1 Length = 356 Score = 73.2 bits (178), Expect = 1e-011 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = +2
G QT++ S +I+++F+ NEN K +Y H+TCATDT NIL+VFNAV+DI+LN T Sbjct: 294 GPQTYEGCSEFIKQQFINQNENPKKSIYPHLTCATDTNNILVVFNAVKDIVLNLT 348 --------- gnl|ti|820222195 name:POAA-aab93g08.b1 mate_pair:820222792 (755 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|NP_080447.1| nuclear VCP-like [Mus musculus] >gi|741502... 67 6e-010 gb|AAH31847.1| Nuclear VCP-like [Mus musculus] 67 6e-010 dbj|BAC35806.1| unnamed protein product [Mus musculus] 67 6e-010 gb|AAH12105.1| NVL protein [Homo sapiens] 66 1e-009 ref|NP_996671.1| nuclear VCP-like isoform 2 [Homo sapiens] ... 66 1e-009 ref|NP_002524.2| nuclear VCP-like isoform 1 [Homo sapiens] ... 66 1e-009 ref|XP_514229.1| PREDICTED: nuclear VCP-like [Pan troglodytes] 66 1e-009 ref|XP_611864.2| PREDICTED: similar to Nuclear valosin-cont... 66 1e-009 ref|XP_419391.1| PREDICTED: similar to Nuclear valosin-cont... 66 1e-009 ref|XP_537239.2| PREDICTED: similar to Nuclear valosin-cont... 66 1e-009 >ref|NP_080447.1| nuclear VCP-like [Mus musculus] dbj|BAE24409.1| unnamed protein product [Mus musculus] dbj|BAB23464.1| unnamed protein product [Mus musculus] sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like (Nuclear VCP-like protein) (NVLp) Length = 855 Score = 67.0 bits (162), Expect = 6e-010 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = -1
NN T V+VIGATNRPD+LD ALRRAGRFD+E+ LG+PD AAR R+ Sbjct: 395 NNVAATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIPDEAARERI 442 Score = 42.0 bits (97), Expect = 0.021 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = -1 Query: 275 VIVIGATNRPDALDSALRRAGRFDKEITLGVPDLAARSRVCPPPSSCFSYPP 120 V ++ ATNRPD +D A+ R GR DK + +G+P A R + + + PP Sbjct: 717 VFILAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRVAILKTITKNGTKPP 768 -------------------------- gnl|ti|820222197 name:POAA-aab93g10.b1 mate_pair:820222793 (867 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAG41774.1| Cat [Promoter probe vector pPR9TT] 388 e-106 ------------------------------ gnl|ti|820222793 name:POAA-aab93g10.g1 mate_pair:820222197 (909 letters)
Score E
Sequences producing significant alignments: (bits) Value pir||JQ1541 hypothetical 16.9K protein - Salmonella typhimu... 258 2e-067 --------------------- gnl|ti|818424683 name:POAA-aac10a10.b1 mate_pair:820222214 (869 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAA70417.1| gamma-tubulin [Physarum polycephalum] 421 e-116 gb|AAS38886.1| similar to Dictyostelium discoideum (Slime m... 322 8e-087 ref|XP_645459.1| gamma tubulin [Dictyostelium discoideum] >... 322 8e-087 emb|CAA09992.1| gamma-tubulin [Paramecium tetraurelia] 319 7e-086 emb|CAA09991.1| gamma-tubulin [Paramecium tetraurelia] 318 1e-085 sp|Q9XFG3|TBG_PHYPA Tubulin gamma chain (Gamma tubulin) >gi... 310 4e-083 emb|CAA48932.1| gamma tubulin [Anemia phyllitidis] >gi|4648... 310 5e-083 ref|NP_196181.1| GTP binding / GTPase/ structural molecule ... 310 5e-083 gb|AAP85519.1| gamma-tubulin [Haplomitrium mnioides] 309 9e-083 gb|AAM44306.1| tubulin gamma chain [Conocephalum japonicum] 309 9e-083 >emb|CAA70417.1| gamma-tubulin [Physarum polycephalum] Length = 454 Score = 421 bits (1082), Expect = e-116 Identities = 213/217 (98%), Positives = 214/217 (98%) Frame = +2
ASTTTLRYPGYMNNDLIGLLASLIPTPRCHFLMTGYTPLTVDRQRQNVHKT+VLDVMRRL Sbjct: 235 ASTTTLRYPGYMNNDLIGLLASLIPTPRCHFLMTGYTPLTVDRQRQNVHKTTVLDVMRRL 294
LQPQNIMVSTSMRNGKYISILNIIQGEVDPTQVHNSLQ LRERKLASFIDWGPASIQVAL Sbjct: 295 LQPQNIMVSTSMRNGKYISILNIIQGEVDPTQVHNSLQGLRERKLASFIDWGPASIQVAL 354
SRKSPYVKTAHRVSGLMLANHTSIHSLFSQIIKQYDTLRRHNAFLNNYVKESIFSDSLDE Sbjct: 355 SRKSPYVKTAHRVSGLMLANHTSIHSLFSQIIKQYDTLRRHNAFLNNYVKESIFSDSLDE 414
FDSSREVVASLVDEYIAAE SDYVNYGMDK QSGSNN Sbjct: 415 FDSSREVVASLVDEYIAAEGSDYVNYGMDKGQSGSNN 451 ---------------- gnl|ti|818424684 name:POAA-aac10a11.b1 mate_pair:820222215 (899 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAG00328.1| unnamed protein product [Tetraodon nigrovir... 69 3e-010 gb|AAH97531.1| Unknown (protein for MGC:114655) [Xenopus la... 68 4e-010 gb|AAH44511.1| CDC5 cell division cycle 5-like [Danio rerio... 67 1e-009 ref|NP_690023.1| cell division cycle 5-like [Mus musculus] ... 67 1e-009 ref|XP_518512.1| PREDICTED: similar to CDC5-like; Cell divi... 67 1e-009 ref|XP_420058.1| PREDICTED: similar to KIAA0432 [Gallus gal... 67 1e-009 ref|XP_532156.2| PREDICTED: similar to CDC5-like [Canis fam... 67 1e-009 dbj|BAD32228.1| mKIAA0432 protein [Mus musculus] 67 1e-009 ref|NP_001008202.1| cdc5l-prov protein [Xenopus tropicalis]... 67 1e-009 ref|NP_445979.1| cell division cycle 5-like [Rattus norvegi... 67 1e-009 >emb|CAG00328.1| unnamed protein product [Tetraodon nigroviridis] Length = 825 Score = 68.6 bits (166), Expect = 3e-010 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = +1
D +L EAQNL+ALTN TPLKGG NTPLH SDFSG TP+ ++IQ + P Sbjct: 347 DRILQEAQNLMALTNIDTPLKGGLNTPLHESDFSGVTPQKQQIQTPNTVLSTP 399 --------------------------------------- gnl|ti|820222218 name:POAA-aac10b06.g1 mate_pair:818424688 (360 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_641686.1| protein kinase A regulatory subunit [Dicty... 71 1e-011 ref|XP_743202.1| cAMP-dependent protein kinase regulatory s... 69 7e-011 gb|AAF44694.1| cAMP-dependent protein kinase regulatory sub... 68 9e-011 gb|AAX28284.2| SJCHGC04695 protein [Schistosoma japonicum] 65 6e-010 ref|XP_849179.1| PREDICTED: similar to cAMP-dependent prote... 64 1e-009 ref|XP_858066.1| PREDICTED: similar to cAMP-dependent prote... 64 1e-009 ref|XP_857982.1| PREDICTED: similar to cAMP-dependent prote... 64 1e-009 ref|XP_857939.1| PREDICTED: similar to cAMP-dependent prote... 64 1e-009 ref|XP_857899.1| PREDICTED: similar to cAMP-dependent prote... 64 1e-009 ref|XP_857824.1| PREDICTED: similar to protein kinase, cAMP... 64 1e-009 >ref|XP_641686.1| protein kinase A regulatory subunit [Dictyostelium discoideum] sp|P05987|KAPR_DICDI cAMP-dependent protein kinase regulatory subunit gb|EAL67645.1| protein kinase A regulatory subunit [Dictyostelium discoideum] gb|AAA33236.1| protein kinase regulatory subunit (E.C 2.7.1.37) Length = 327
Identities = 32/67 (47%), Positives = 44/67 (65%) Frame = +2
DYFGE+ALL D+PRAA V ++G + + L R+ F L GP +++L+RNM Y Q N PP Sbjct: 258 DYFGEIALLTDRPRAATVTSIGYTKCVELDRQRFNRLCGPIDQMLRRNMETYNQFLNRPP 317
P + S
Sbjct: 318 SSPNLTS 324 ----------------------- gnl|ti|820222222 name:POAA-aac10b11.g1 mate_pair:818424691 (764 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_641226.1| hypothetical protein DDB0206359 [Dictyoste... 71 3e-011 gb|AAS77441.1| LP04080p [Drosophila melanogaster] 52 3e-005 emb|CAE70245.1| Hypothetical protein CBG16734 [Caenorhabdit... 52 3e-005 ref|XP_635530.1| putative myb transcription factor [Dictyos... 51 4e-005 gb|AAX27634.2| SJCHGC01769 protein [Schistosoma japonicum] 51 4e-005 ref|XP_800768.1| PREDICTED: hypothetical protein XP_795675,... 51 4e-005 gb|EAA76175.1| hypothetical protein FG09652.1 [Gibberella z... 50 6e-005 ref|XP_800637.1| PREDICTED: hypothetical protein XP_795544 ... 50 8e-005 gb|AAH85813.1| Mpp7_predicted protein [Rattus norvegicus] 50 8e-005 ref|XP_669731.1| hypothetical protein PB400375.00.0 [Plasmo... 50 1e-004 >ref|XP_641226.1| hypothetical protein DDB0206359 [Dictyostelium discoideum] gb|EAL67263.1| hypothetical protein DDB0206359 [Dictyostelium discoideum] Length = 397
Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +1
+YRTNSLYP N P++KLLGLKT+V LSPEVP AV+ +ENN+ L+++ Sbjct: 161 LYRTNSLYPANFPFIKLLGLKTVVQLSPEVPIKAVSSFFQENNINLIHL 209 -------------- gnl|ti|820222223 name:POAA-aac10b12.g1 mate_pair:818424692 (636 letters)
Score E
Sequences producing significant alignments: (bits) Value sp|P37167|ACTP_ACACA Actophorin >gi|155621|gb|AAA02909.1| a... 76 1e-012 pdb|1CNU|A Chain A, Phosphorylated Actophorin From Acantamo... 76 1e-012 pdb|1AHQ| Recombinant Actophorin 76 1e-012 ref|XP_760461.1| hypothetical protein UM04314.1 [Ustilago m... 75 1e-012 gb|AAK85273.1| cofilin [Pichia angusta] 71 3e-011 emb|CAB11258.1| cof1 [Schizosaccharomyces pombe] >gi|191156... 69 1e-010 ref|XP_505682.1| hypothetical protein [Yarrowia lipolytica]... 68 2e-010 gb|AAS52155.1| ADR235Wp [Ashbya gossypii ATCC 10895] >gi|45... 65 2e-009 emb|CAA88007.1| ORF L0596 [Saccharomyces cerevisiae] 65 2e-009 emb|CAA97502.1| COF1 [Saccharomyces cerevisiae] >gi|399275|... 65 2e-009 >sp|P37167|ACTP_ACACA Actophorin gb|AAA02909.1| actophorin Length = 138
Identities = 43/94 (45%), Positives = 52/94 (55%) Frame = -2
DGG R KI F+LW PD+A IKSKM+YTST Sbjct: 73 DGGQRNKITFILW-------------------------------APDSAPIKSKMMYTST 101
KD+I+KKLVGI E+QATD AEIS +AV E+ K+ Sbjct: 102 KDSIKKKLVGIQVEVQATDAAEISEDAVSERAKK 135 ---------- gnl|ti|818424700 name:POAA-aac10c09.b1 mate_pair:820222229 (700 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_886302.1| PREDICTED: similar to Serine/threonine pro... 155 9e-037 ref|XP_886087.1| PREDICTED: similar to Serine/threonine pro... 155 9e-037 ref|XP_886067.1| PREDICTED: similar to Serine/threonine pro... 155 9e-037 ref|XP_510919.1| PREDICTED: similar to protein phosphatase ... 154 3e-036 ref|XP_886287.1| PREDICTED: similar to Serine/threonine pro... 154 3e-036 ref|XP_886258.1| PREDICTED: similar to Serine/threonine pro... 154 3e-036 ref|XP_886241.1| PREDICTED: similar to Serine/threonine pro... 154 3e-036 ref|XP_687837.1| PREDICTED: similar to serine/threonine pho... 154 3e-036 ref|XP_708964.1| PREDICTED: similar to serine/threonine pho... 154 3e-036 ref|NP_599186.1| protein phosphatase 4 (formerly X), cataly... 154 3e-036 >ref|XP_886302.1| PREDICTED: similar to Serine/threonine protein phosphatase 4 catalytic subunit (PP4C) (Pp4) (Protein phosphatase X) (PP-X) isoform 20 [Bos taurus] Length = 223 Score = 155 bits (393), Expect = 9e-037 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = +3
QVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSV VWRYCTEIFDYLSLSA+ID KI Sbjct: 17 QVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKI 76
FCVHGGLSPSI TLDQ+ Sbjct: 77 FCVHGGLSPSIQTLDQI 93 ---------------------------------- gnl|ti|820222229 name:POAA-aac10c09.g1 mate_pair:818424700 (321 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_638686.1| hypothetical protein DDB0185934 [Dictyoste... 50 2e-005 ref|XP_393479.2| PREDICTED: similar to ENSANGP00000010200 [... 48 9e-005 emb|CAH71592.1| DnaJ (Hsp40) homolog, subfamily C, member 1... 44 0.001 ref|XP_514344.1| PREDICTED: similar to hypothetical protein... 44 0.001 ref|XP_584875.2| PREDICTED: similar to DnaJ (Hsp40) homolog... 44 0.001 ref|XP_425731.1| PREDICTED: similar to hypothetical protein... 44 0.001 ref|XP_849469.1| PREDICTED: similar to DnaJ (Hsp40) homolog... 44 0.001 ref|XP_858801.1| PREDICTED: similar to DnaJ (Hsp40) homolog... 44 0.001 ref|XP_858761.1| PREDICTED: similar to DnaJ (Hsp40) homolog... 44 0.001 ref|XP_858724.1| PREDICTED: similar to DnaJ (Hsp40) homolog... 44 0.001 >ref|XP_638686.1| hypothetical protein DDB0185934 [Dictyostelium discoideum] gb|EAL65320.1| hypothetical protein DDB0185934 [Dictyostelium discoideum] Length = 575
Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1
IPL YLVEDS+L+LH + K+ LLGF+DPRI E K+L + Y Sbjct: 508 IPLQYLVEDSKLVLHGNNKKSDLLGFWDPRISEEKQLKVTY 548 ---------------- gnl|ti|820222241 name:POAA-aac10e07.g1 mate_pair:818424712 (898 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAX30301.1| unknown [Schistosoma japonicum] 81 6e-014 emb|CAH00945.1| unnamed protein product [Kluyveromyces lact... 78 4e-013 ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 68 4e-010 emb|CAB51041.1| putative transcription factor [Periplaneta ... 65 2e-009 gb|AAX27748.1| unknown [Schistosoma japonicum] 62 2e-008 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 60 8e-008 dbj|BAD26579.1| cytochrome P450 like_TBP [Citrullus lanatus] 55 3e-006 gb|EAA21327.1| putative senescence-associated protein [Plas... 52 4e-005 ref|XP_767406.1| hypothetical protein GLP_748_1200_211 [Gia... 50 8e-005 dbj|BAD18905.1| rRNA intron-encoded endonuclease [Thermopro... 45 0.003 >gb|AAX30301.1| unknown [Schistosoma japonicum] Length = 55 Score = 80.9 bits (198), Expect = 6e-014 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -1
LI DAHEW+NEIPTVPTYYLAKPQPRERAW N RGKKTL + W Sbjct: 5 LISDAHEWMNEIPTVPTYYLAKPQPRERAWRNQRGKKTLLSLTLVW 50 ----------- gnl|ti|820222247 name:POAA-aac10f06.g1 mate_pair:818424721 (901 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_640668.1| hypothetical protein DDB0205575 [Dictyoste... 49 2e-004 ref|XP_394455.2| PREDICTED: similar to Protein KIAA0274 [Ap... 48 4e-004 ref|XP_504713.1| hypothetical protein [Yarrowia lipolytica]... 48 5e-004 gb|AAS51725.1| ADL195Cp [Ashbya gossypii ATCC 10895] >gi|45... 47 0.001 ref|XP_329813.1| hypothetical protein [Neurospora crassa] >... 45 0.004 gb|EAL93963.1| SacI domain protein [Aspergillus fumigatus A... 44 0.006 emb|CAG58433.1| unnamed protein product [Candida glabrata C... 44 0.006 ref|XP_680583.1| hypothetical protein AN7314.2 [Aspergillus... 44 0.006 gb|EAL40547.1| ENSANGP00000029052 [Anopheles gambiae str. P... 40 0.11 gb|EAA09263.2| ENSANGP00000016948 [Anopheles gambiae str. P... 40 0.11 >ref|XP_640668.1| hypothetical protein DDB0205575 [Dictyostelium discoideum] gb|EAL66695.1| hypothetical protein DDB0205575 [Dictyostelium discoideum] Length = 1391
Identities = 33/107 (30%), Positives = 42/107 (39%), Gaps = 1/107 (0%) Frame = -1
YND F WNH LL+ + + V WVLPIIHG++ Q I Sbjct: 276 YNDQFTWNHFLLECLVDQVKTWYWVLPIIHGYFVQDKI---------------------- 313
+FG+ +D ILIARRSR +AG Sbjct: 314 --------------------------DIFGKGLDLILIARRSRYYAG 334 -------------------- gnl|ti|818424727 name:POAA-aac10g03.b1 mate_pair:820222255 (898 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAJ00344.1| chloramphenicol acetyltransferase [Aeromona... 176 1e-042 ------------------ gnl|ti|820222255 name:POAA-aac10g03.g1 mate_pair:818424727 (901 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] >gi|9507257|ref|... 60 8e-008 ref|ZP_00374729.1| conserved hypothetical protein [Wolbachi... 58 5e-007 ref|NP_194886.1| SRZ-22 [Arabidopsis thaliana] >gi|7270061|... 51 6e-005 ref|XP_472173.1| OSJNBa0069D17.3 [Oryza sativa (japonica cu... 49 2e-004 emb|CAA05352.1| RSZp22 protein [Arabidopsis thaliana] 49 3e-004 gb|AAT85130.1| putative polyprotein [Oryza sativa (japonica... 48 5e-004 gb|ABA92936.1| retrotransposon protein, putative, Ty1-copia... 47 7e-004 gb|ABA91220.1| retrotransposon protein, putative, unclassif... 47 0.001 gb|ABA91982.1| retrotransposon protein, putative, Ty1-copia... 47 0.001 ref|XP_469280.1| gag-pol polyprotein [Oryza sativa (japonic... 47 0.001 >gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] ref|NP_040359.1| hypothetical protein pColE1_04 [Plasmid ColE1] Length = 96
Identities = 35/63 (55%), Positives = 40/63 (63%) Frame = +2
+RSFFSARNLLLANKKTTAT+GGLFA ++ F +YC SSVA P L Sbjct: 1 MRSFFSARNLLLANKKTTATNGGLFAGSRATNSFSEGNWLQQSADTKYCPSSVAVVGPLL 60
Q L
Sbjct: 61 QEL 63 ---------------- gnl|ti|820222262 name:POAA-aac10g11.g1 mate_pair:818424734 (891 letters)
Score E
Sequences producing significant alignments: (bits) Value sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit T... 86 2e-015 ref|XP_682677.1| hypothetical protein AN9408.2 [Aspergillus... 84 9e-015 gb|AAB41494.1| fatty acid synthase, beta subunit [Emericell... 84 9e-015 ref|XP_681083.1| putative sterigmatocystin biosynthesis fat... 82 2e-014 sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis... 82 2e-014 gb|EAL20517.1| hypothetical protein CNBE4370 [Cryptococcus ... 79 2e-013 gb|AAW43793.1| fatty-acid synthase complex protein, putativ... 79 2e-013 gb|EAA69376.1| hypothetical protein FG00037.1 [Gibberella z... 79 2e-013 ref|XP_500912.1| hypothetical protein [Yarrowia lipolytica]... 77 8e-013 emb|CAA42211.1| fatty-acid synthase [Yarrowia lipolytica] 77 8e-013 >sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC [Includes: 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase ; Enoyl-[acyl-carrier-protein] reductase [NADH] ; [Acyl-carrier-protein] acetyltransferase ; [Acyl-carrier-protein] malonyltransferase ; S-acyl fatty acid synthase thioesterase ] gb|AAC62818.1| putative fatty acid synthase beta [Cochliobolus carbonum] Length = 2080
Identities = 46/101 (45%), Positives = 64/101 (63%) Frame = +1
D ++FKKDSLW SE +EAV D+D+ RTCILQGPVA ++S +EPI +ILGSIHQ + Sbjct: 1027 DFEFFFKKDSLWQSEDLEAVVDQDVGRTCILQGPVAAKYSVKVDEPIAEILGSIHQGHVT 1086
LR E ++++ ++ GG S+ D+ L D I Sbjct: 1087 RLREERYCATLDSIP-----FVEYFGGESIQLDMSSLADGI 1122 Score = 40.0 bits (92), Expect = 0.11 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 4/86 (4%) Frame = +3 Query: 81 LRRTKQRFSTKVEIS---DEARIYSHPTEVVEEFVASSPRIKTQLMAAEDVDYFLYLA-R 248 + R ++RF+TK S + + P ++ + + + + DV+YFL L R Sbjct: 953 VNRLEERFTTKTVQSYLIQDCKTIDDPYNIITVVLLQYQQAIKETILTPDVEYFLLLCKR 1012
G KPV F+P +D+ + + +W Sbjct: 1013 RGQKPVPFVPALDEDFEFFFKKDSLW 1038 ----------------- gnl|ti|820222267 name:POAA-aac10h06.g1 mate_pair:818424738 (928 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] >gi|9507257|ref|... 122 1e-026 sp|P03851|YPB3_ECOLI Hypothetical 9.4 kDa protein 117 7e-025 ref|ZP_00374729.1| conserved hypothetical protein [Wolbachi... 81 6e-014 pir||A53577 ascites sialoglycoprotein 1 - rat (fragments) 47 0.001 gb|AAA85523.1| Heterodimeric complex composed of a mucin su... 47 0.001 >gb|AAB59124.1| 10.2 kd ORF [Plasmid ColE1] ref|NP_040359.1| hypothetical protein pColE1_04 [Plasmid ColE1] Length = 96
Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = +2
+RSFFSARNLLLANKKTTAT+GGLFAGSRATNSFSEGNWLQQSADTKYC SSVAVV P L Sbjct: 1 MRSFFSARNLLLANKKTTATNGGLFAGSRATNSFSEGNWLQQSADTKYCPSSVAVVGPLL 60
QELCST
Sbjct: 61 QELCST 66 --------------- gnl|ti|820222359 name:POAA-aac11b06.g1 mate_pair:818424829 (911 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAE21361.1| conserved hypothetical protein [Prochloroco... 85 4e-015 ref|ZP_00675690.1| Alkyl hydroperoxide reductase/ Thiol spe... 83 1e-014 ref|ZP_00516641.1| Alkyl hydroperoxide reductase/ Thiol spe... 82 2e-014 ref|ZP_00655346.1| Alkyl hydroperoxide reductase/ Thiol spe... 82 3e-014 ref|NP_441096.1| membrane protein [Synechocystis sp. PCC 68... 81 4e-014 emb|CAC47046.1| CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobi... 75 4e-012 ref|YP_343352.1| Alkyl hydroperoxide reductase/ Thiol speci... 74 5e-012 emb|CAA06680.3| atypical 2-Cys peroxiredoxin [Rhizobium etl... 74 9e-012 ref|YP_034080.1| expressed protein [Bartonella henselae str... 73 1e-011 emb|CAD31366.1| CONSERVED HYPOTHETICAL-PEROXIREDOXIN 2 FAMI... 72 2e-011 >emb|CAE21361.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT Yüklə 3,49 Mb. Dostları ilə paylaş:
|