Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
|
-------------------- gnl|ti|818422389 name:POAA-aaa26i09.g1 mate_pair:820221677 (363 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|EAA22566.1| hypothetical protein [Plasmodium yoelii yoelii] 54 2e-006 emb|CAC80206.1| Bac5 protein [Capra hircus] >gi|7993734|sp|... 44 0.002 emb|CAI79180.1| Hypothetical protein W02B9.2 [Caenorhabditi... 44 0.002 dbj|BAB15254.1| unnamed protein product [Homo sapiens] 44 0.002 emb|CAA41809.1| vicilin-like embryo storage protein [Zea mays] 43 0.003 gb|AAF49476.1| CG4784-PA [Drosophila melanogaster] >gi|1786... 43 0.003 ref|XP_637435.1| hypothetical protein DDB0187231 [Dictyoste... 43 0.004 gb|EAA16264.1| hypothetical protein [Plasmodium yoelii yoelii] 43 0.004 emb|CAB01605.1| UL36 [Bovine herpesvirus 1] >gi|2653311|emb... 43 0.004 ref|YP_294122.1| putative membrane protein [Emiliania huxle... 42 0.005 >gb|EAA22566.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 371
Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2
G ++ K GEKG G GGEKGGEKG EKGGEKGGEK Sbjct: 77 GNRQFPKNGEKG-GEKGGEKGGEKGGEKGGEKGGEK 111 Score = 43.5 bits (101), Expect = 0.002 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 308 GEKGGEKGVEKGGEKGGEKG 249 GEKGGEKG EKGGEKGGEKG Sbjct: 85 GEKGGEKGGEKGGEKGGEKG 104
gnl|ti|820221681 name:POAA-aaa26i17.b1 mate_pair:818422393 (600 letters) Score E
Sequences producing significant alignments: (bits) Value ref|YP_302383.1| dihydroxyacid dehydratase phosphogluconate... 59 1e-007 gb|AAS73032.1| predicted dihydroxyacid dehydratase [uncultu... 57 4e-007 ref|NP_693545.1| dihydroxy-acid dehydratase [Oceanobacillus... 57 4e-007 gb|AAT38584.1| predicted dihydroxy-acid dehydratase [uncult... 56 9e-007 ref|YP_114512.1| dihydroxy-acid dehydratase [Methylococcus ... 56 9e-007 ref|ZP_00473703.1| Dihydroxy-acid dehydratase [Chromohaloba... 55 2e-006 ref|YP_001071.1| dihydroxy-acid dehydratase [Leptospira int... 55 2e-006 ref|NP_713139.1| Dihydroxy-acid dehydratase [Leptospira int... 55 2e-006 gb|AAB81918.1| IlvD [Lactococcus lactis] 54 3e-006 ref|NP_267379.1| dihydroxy-acid dehydratase [Lactococcus la... 54 3e-006 >ref|YP_302383.1| dihydroxyacid dehydratase phosphogluconate dehydratase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
dbj|BAE19438.1| dihydroxyacid dehydratase phosphogluconate dehydratase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length = 564 Score = 58.5 bits (140), Expect = 1e-007 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = +3
S+S V +K D + G A++ LL+KGI +DIMTK+AFENAITV++A+GGSTN + Sbjct: 227 SASHPAVSTNKSKDSRAAGK-AVYKLLEKGIYPKDIMTKEAFENAITVVMALGGSTNAI 284 --------------------------------- gnl|ti|820221682 name:POAA-aaa26i19.b1 mate_pair:818422394 (598 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAX52704.1| CG33505-PA [Drosophila melanogaster] >gi|214... 84 3e-015 gb|EAL26248.1| GA10166-PA [Drosophila pseudoobscura] 83 5e-015 gb|EAA11310.2| ENSANGP00000021079 [Anopheles gambiae str. P... 79 8e-014 ref|XP_394355.2| PREDICTED: similar to GA10166-PA [Apis mel... 77 3e-013 gb|AAR01650.1| putative U3 small nucleolar ribonucleoprotei... 75 1e-012 ref|NP_192450.1| nucleic acid binding / nucleotide binding ... 75 2e-012 ref|XP_414243.1| PREDICTED: similar to U3 small nucleolar R... 74 4e-012 gb|AAY21208.1| U3-55K-like protein 2 [Arabidopsis thaliana] 71 3e-011 ref|XP_692816.1| PREDICTED: hypothetical protein XP_687724 ... 70 4e-011 emb|CAG06962.1| unnamed protein product [Tetraodon nigrovir... 70 6e-011 >gb|AAX52704.1| CG33505-PA [Drosophila melanogaster] gb|AAM49889.1| LD17611p [Drosophila melanogaster] ref|NP_001014529.1| CG33505-PA [Drosophila melanogaster] Length = 484
Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 8/113 (7%) Frame = +2
+KKPI T Q AH ++G W+TA+ + +DL TG DG VRLW+ + + I Sbjct: 369 KKKPICTTQLAHGVGENGVANWITAIAVVVNTDLVATGSCDGCVRLWQTNPNARKMNLIQ 428
I + GFING+ F G++L +A GQEHRLGRW R+ + +N VV+L + LQ Sbjct: 429 SISIAGFINGLAFNADGSKLFVATGQEHRLGRWWRLKEAKN--QVVVLDVKLQ 479 --------------- gnl|ti|818422398 name:POAA-aaa26k03.g1 mate_pair:820221686 (394 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_638905.1| dolichyl-phosphate-glucose alpha-1,3-gluco... 73 3e-012 emb|CAA17695.1| SPBC3F6.06c [Schizosaccharomyces pombe] >gi... 67 2e-010 gb|EAL38988.1| ENSANGP00000026069 [Anopheles gambiae str. P... 62 5e-009 gb|EAA14783.2| ENSANGP00000021398 [Anopheles gambiae str. P... 62 5e-009 ref|XP_364465.1| hypothetical protein MG09310.4 [Magnaporth... 60 2e-008 ref|XP_476714.1| putative alpha 3 glucosyltransferase [Oryz... 60 2e-008 emb|CAG31431.1| hypothetical protein [Gallus gallus] >gi|45... 60 2e-008 ref|NP_001011458.1| hypothetical protein LOC496948 [Xenopus... 60 3e-008 ref|XP_502922.1| hypothetical protein [Yarrowia lipolytica]... 59 4e-008 gb|AAI01851.1| Asparagine-linked glycosylation 6 homolog (y... 59 7e-008 >ref|XP_638905.1| dolichyl-phosphate-glucose alpha-1,3-glucosyltransferase [Dictyostelium discoideum] gb|EAL65535.1| glycosyltransferase [Dictyostelium discoideum] Length = 518
Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = +3
F+YNGVSLGL L + + I+ D LLAS FF LSLN+KQM LYYS + FFYLL ++F Sbjct: 176 FQYNGVSLGLGLFAITFIIRDQQLLASFFFVLSLNYKQMCLYYSPAFFFYLLLSNF 231 ------------- gnl|ti|820221703 name:POAA-aaa26o01.b1 mate_pair:818422421 (599 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAL31950.1| CDH1-D [Gallus gallus] 79 1e-013 ref|XP_428325.1| PREDICTED: similar to Ac1147, partial [Gal... 64 3e-009 gb|EAA17111.1| hypothetical protein [Plasmodium yoelii yoelii] 59 8e-008 gb|AAP92584.1| Ab2-057 [Rattus norvegicus] >gi|32492570|gb|... 59 1e-007 ref|XP_520857.1| PREDICTED: hypothetical protein XP_520857 ... 59 1e-007 ref|XP_358030.2| PREDICTED: similar to Ac1147 [Mus musculus] 58 2e-007 gb|EAA16550.1| hypothetical protein [Plasmodium yoelii yoelii] 54 3e-006 gb|ABA40767.1| SJCHGC01014 protein [Schistosoma japonicum] 50 5e-005 ref|XP_578947.1| PREDICTED: similar to Ac1147 [Rattus norve... 48 2e-004 dbj|BAB66226.1| 109aa long hypothetical protein [Sulfolobus... 45 0.002 >gb|AAL31950.1| CDH1-D [Gallus gallus] Length = 451
Identities = 47/84 (55%), Positives = 53/84 (63%) Frame = -3
NDP+AGSPT TLLRLLLPL V + + V P L +PIGSSDGRCVQR Sbjct: 250 NDPSAGSPTETLLRLLLPLDSQVRPSSRRSGRAVADPAGADPRTSLNHPIGSSDGRCVQR 309
AGT+ST+ D LL IPR IIA Sbjct: 310 AGTYSTRAYDPHLLGIPRSWGIIA 333 -------------------- gnl|ti|818421448 name:POAA-aaa27a06.b1 mate_pair:818423108 (834 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAA77460.2| Hypothetical protein ZK637.1 [Caenorhabditi... 50 7e-005 emb|CAE57609.1| Hypothetical protein CBG00590 [Caenorhabdit... 49 3e-004 gb|AAH85429.1| Zgc:101741 [Danio rerio] >gi|55925337|ref|NP... 45 0.002 ref|XP_709394.1| PREDICTED: similar to SV2 related protein ... 45 0.002 ref|XP_709392.1| PREDICTED: similar to SV2 related protein ... 45 0.002 ref|XP_416558.1| PREDICTED: similar to putative transmembra... 45 0.004 ref|XP_227523.3| PREDICTED: similar to putative transmembra... 44 0.005 ref|XP_682763.1| PREDICTED: similar to SV2 related protein,... 44 0.009 dbj|BAC26569.1| unnamed protein product [Mus musculus] >gi|... 42 0.026 ref|XP_736418.1| hypothetical protein PC104116.00.0 [Plasmo... 42 0.026 >emb|CAA77460.2| Hypothetical protein ZK637.1 [Caenorhabditis elegans] emb|CAA80131.2| Hypothetical protein ZK637.1 [Caenorhabditis elegans] ref|NP_498960.2| ZK637.1 [Caenorhabditis elegans] sp|P30638|YOU1_CAEEL Hypothetical protein ZK637.1 in chromosome III Length = 520 Score = 50.4 bits (119), Expect = 7e-005 Identities = 22/56 (39%), Positives = 37/56 (66%) Frame = +1
+YPT +R VG G S+M+R+G ++TPF+A +A K+ L +P +Y A++G + Sbjct: 450 VYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEKS---LSLPIGIYGTAAILGLI 502
gnl|ti|818423108 name:POAA-aaa27a06.g1 mate_pair:818421448 (753 letters) Score E
Sequences producing significant alignments: (bits) Value emb|CAA77460.2| Hypothetical protein ZK637.1 [Caenorhabditi... 52 2e-005 emb|CAE57609.1| Hypothetical protein CBG00590 [Caenorhabdit... 50 8e-005 gb|AAH85429.1| Zgc:101741 [Danio rerio] >gi|55925337|ref|NP... 49 2e-004 ref|XP_709394.1| PREDICTED: similar to SV2 related protein ... 49 2e-004 ref|XP_709392.1| PREDICTED: similar to SV2 related protein ... 49 2e-004 ref|XP_227523.3| PREDICTED: similar to putative transmembra... 47 9e-004 ref|XP_416558.1| PREDICTED: similar to putative transmembra... 46 0.001 ref|XP_528265.1| PREDICTED: similar to hypothetical protein... 45 0.003 ref|XP_682763.1| PREDICTED: similar to SV2 related protein,... 45 0.003 dbj|BAC26569.1| unnamed protein product [Mus musculus] >gi|... 44 0.007 >emb|CAA77460.2| Hypothetical protein ZK637.1 [Caenorhabditis elegans] emb|CAA80131.2| Hypothetical protein ZK637.1 [Caenorhabditis elegans] ref|NP_498960.2| ZK637.1 [Caenorhabditis elegans] sp|P30638|YOU1_CAEEL Hypothetical protein ZK637.1 in chromosome III Length = 520 Score = 52.0 bits (123), Expect = 2e-005 Identities = 22/56 (39%), Positives = 38/56 (67%) Frame = -1
+YPT +R+VG G S+M+R+G ++TPF+A +A K+ L +P +Y A++G + Sbjct: 450 VYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEKS---LSLPIGIYGTAAILGLI 502 ----------- gnl|ti|818421450 name:POAA-aaa27a10.b1 mate_pair:818423110 (930 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|ABB17069.1| chloramphenicol acetyl transferase [Moss gen... 428 e-118 gb|AAC53603.1| chloramphenicol acetyltransferase 428 e-118 dbj|BAA03718.1| PP-CAT [Photobacterium damselae subsp. pisc... 428 e-118 ------------ gnl|ti|818423112 name:POAA-aaa27a14.g1 mate_pair:818421452 (722 letters) Score E
Sequences producing significant alignments: (bits) Value ref|XP_648235.1| Rab geranylgeranyltransferase beta subunit... 65 2e-009 gb|EAN95842.1| geranylgeranyl transferase type II beta subu... 64 5e-009 gb|AAX80948.1| geranylgeranyl transferase type II beta subu... 63 8e-009 emb|CAJ08127.1| geranylgeranyltransferase, putative [Leishm... 62 1e-008 ref|XP_422548.1| PREDICTED: similar to Rab geranylgeranyltr... 62 2e-008 ref|XP_661351.1| hypothetical protein AN3747.2 [Aspergillus... 61 4e-008 gb|AAM65965.1| Rab geranylgeranyltransferase, beta subunit ... 60 9e-008 ref|NP_568259.1| catalytic [Arabidopsis thaliana] >gi|28466... 60 9e-008 ref|XP_504498.1| hypothetical protein [Yarrowia lipolytica]... 60 9e-008 ref|NP_974770.1| catalytic [Arabidopsis thaliana] 60 9e-008 >ref|XP_648235.1| Rab geranylgeranyltransferase beta subunit, putative [Entamoeba histolytica HM-1:IMSS] gb|EAL42849.1| Rab geranylgeranyltransferase beta subunit, putative [Entamoeba histolytica HM-1:IMSS] Length = 315 Score = 65.5 bits (158), Expect = 2e-009 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -1
RF Y AV L L+G LD++ + A + Y+ +C NFDGAFGCIPGAESHAGQ+ Sbjct: 131 RFVYCAVLALTLIGKLDVI-NTEAAVNYLMKCMNFDGAFGCIPGAESHAGQT 181 ------------------ gnl|ti|818423114 name:POAA-aaa27a18.g1 mate_pair:818421454 (913 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_789388.1| PREDICTED: similar to glucosidase, alpha; ... 72 3e-011 ref|XP_787183.1| PREDICTED: similar to Lysosomal alpha-gluc... 70 8e-011 dbj|BAD45910.1| putative high pI alpha-glucosidase [Oryza s... 67 9e-010 dbj|BAD45913.1| putative alpha-glucosidase [Oryza sativa (j... 67 9e-010 emb|CAG11433.1| unnamed protein product [Tetraodon nigrovir... 67 1e-009 ref|XP_414768.1| PREDICTED: similar to RIKEN cDNA 1110015K0... 67 1e-009 ref|XP_392880.2| PREDICTED: similar to glucosidase, alpha; ... 67 1e-009 dbj|BAC15595.1| acid alpha-glucosidase [Coturnix japonica] ... 67 1e-009 dbj|BAB39467.1| putative alpha-glucosidase [Physcomitrella ... 66 1e-009 ref|XP_143332.5| PREDICTED: RIKEN cDNA 2010204N08 [Mus musc... 66 2e-009 >ref|XP_789388.1| PREDICTED: similar to glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II) [Strongylocentrotus purpuratus] Length = 372
Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2
DICGF GNTT ELCTRWMQLGAFYPFSRNHN+ Y+ Sbjct: 60 DICGFNGNTTEELCTRWMQLGAFYPFSRNHNSLYM 94 ---------------- gnl|ti|818421477 name:POAA-aaa27g02.b1 mate_pair:818423140 (402 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAD83843.1| transglutaminase [Physarum polycephalum] 109 3e-023 dbj|BAC00991.1| transglutaminase [Physarum polycephalum] 109 3e-023 ref|XP_797350.1| PREDICTED: similar to transglutaminase 3, ... 73 3e-012 emb|CAG31844.1| hypothetical protein [Gallus gallus] >gi|57... 70 2e-011 emb|CAA71263.1| transglutiminase [Ciona intestinalis] >gi|7... 70 3e-011 ref|XP_794706.1| PREDICTED: similar to transglutaminase 1 (... 70 3e-011 emb|CAC10657.1| coagulation factor XIIIA [Gallus gallus] >g... 69 4e-011 gb|AAB02857.1| transglutaminase 69 4e-011 dbj|BAC29013.1| unnamed protein product [Mus musculus] >gi|... 69 7e-011 ref|XP_694950.1| PREDICTED: similar to transglutaminase 1 (... 69 7e-011 >dbj|BAD83843.1| transglutaminase [Physarum polycephalum] Length = 855 Score = 109 bits (272), Expect = 3e-023 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3
+YLLNKQPVKYGQCWVYSGTFTTILRALGVPARSVTNFASAHDVPEPTYNR Sbjct: 440 EYLLNKQPVKYGQCWVYSGTFTTILRALGVPARSVTNFASAHDVPEPTYNR 490 --------
gnl|ti|818423140 name:POAA-aaa27g02.g1 mate_pair:818421477 (481 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAD83843.1| transglutaminase [Physarum polycephalum] 59 8e-008 dbj|BAC00991.1| transglutaminase [Physarum polycephalum] 59 8e-008 emb|CAG01157.1| unnamed protein product [Tetraodon nigrovir... 35 0.91 gb|EAL30382.1| GA20373-PA [Drosophila pseudoobscura] 34 2.0 emb|CAG14365.1| unnamed protein product [Tetraodon nigrovir... 33 2.6 ref|XP_640462.1| hypothetical protein DDB0204250 [Dictyoste... 33 4.5 gb|EAA19811.1| Plasmodium vivax PV1H14040_P [Plasmodium yoe... 32 5.9 dbj|BAB67498.1| 253aa long hypothetical protein [Sulfolobus... 32 7.7 gb|AAA32122.1| cytochrome c oxidase III >gi|447158|prf||191... 32 7.7 >dbj|BAD83843.1| transglutaminase [Physarum polycephalum] Length = 855
Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3
+VAWSAHIITYTGKP TVLAKSSATVKVT G Sbjct: 678 NVAWSAHIITYTGKPVTVLAKSSATVKVTKG 708 ------------ gnl|ti|818423160 name:POAA-aaa27k02.g1 mate_pair:818421498 (485 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAD66637.1| phytocyanin protein, PUP2 [Arabidopsis thal... 55 7e-007 dbj|BAD43029.1| predicted GPI-anchored protein [Arabidopsis... 55 9e-007 ref|NP_200198.1| copper ion binding / electron transporter ... 55 9e-007 ref|XP_577536.1| PREDICTED: similar to mucin 10 [Rattus nor... 50 3e-005 ref|XP_578433.1| PREDICTED: similar to Exocyst complex comp... 50 3e-005 dbj|BAC05058.1| unnamed protein product [Homo sapiens] 49 5e-005 ref|NP_001020361.1| hypothetical protein LOC401827 [Homo sa... 49 6e-005 ref|XP_358393.2| PREDICTED: hypothetical protein LOC77763 [... 49 8e-005 ref|XP_618780.1| PREDICTED: similar to keratin associated p... 49 8e-005 ref|XP_357910.3| PREDICTED: similar to GABA(A) receptor-ass... 49 8e-005 >emb|CAD66637.1| phytocyanin protein, PUP2 [Arabidopsis thaliana] Length = 370 Score = 55.5 bits (132), Expect = 7e-007 Identities = 33/84 (39%), Positives = 43/84 (51%), Gaps = 3/84 (3%) Frame = +1
+P HSP+H P HS A HTP+ H+PAH H+PA H PS S HS Sbjct: 215 SPVSHSPSHSPAHTPSHSPA-HTPS-HSPAHAPSHSPAHAPSHSPAHAPSHSPAHSXSHS 272
A+P P+S+ + P P P+T Sbjct: 273 PATPKSPSPSSSPAQSPATPSPMT 296 -------------------- gnl|ti|818423163 name:POAA-aaa27k08.g1 mate_pair:818421501 (912 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|EAL85597.1| ARD/ARD family protein, putative [Aspergill... 85 4e-015 ref|XP_868909.1| hypothetical protein AN9527.2 [Aspergillus... 85 4e-015 ref|XP_322233.1| hypothetical protein [Neurospora crassa] >... 82 3e-014 ref|XP_369928.1| hypothetical protein MG06443.4 [Magnaporth... 79 2e-013 gb|AAW45214.1| hypothetical protein CNH03570 [Cryptococcus ... 77 1e-012 ref|XP_448603.1| unnamed protein product [Candida glabrata]... 75 2e-012 gb|EAA67420.1| hypothetical protein FG02600.1 [Gibberella z... 73 1e-011 gb|AAX55895.1| aci-reductone dioxygenase-like protein [Oryz... 73 2e-011 gb|AAN06863.1| Putative probable submergence induced, nicke... 72 3e-011 gb|AAC19375.1| acireductone dioxygenase 2 [Oryza sativa] 72 3e-011 >gb|EAL85597.1| ARD/ARD family protein, putative [Aspergillus fumigatus Af293] ref|XP_747635.1| hypothetical protein Afu6g04430 [Aspergillus fumigatus Af293] Length = 228
Identities = 39/66 (59%), Positives = 51/66 (77%) Frame = +3
RI++ K+DL++LPAGIYHRF DDK Y+KAMRLF++EPKWTPL+R P D R+ YL Sbjct: 161 RIKLAKDDLIILPAGIYHRFTTDDKNYVKAMRLFQEEPKWTPLNRG-PDVDENSHRQSYL 219
+I+ K
Sbjct: 220 RTIQNK 225 --------------- gnl|ti|818421505 name:POAA-aaa27k18.b1 mate_pair:818423168 (898 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAJ00344.1| chloramphenicol acetyltransferase [Aeromona... 125 2e-027 gb|AAL08441.1| chloramphenicol acetyltransferase [Shigella ... 125 2e-027 gb|ABB17069.1| chloramphenicol acetyl transferase [Moss gen... 125 2e-027 gb|AAV86079.1| chloramphenicol acetyltransferase [Shuttle v... 125 2e-027 emb|CAA71024.1| chloramphenicol acetyltransferase [unidenti... 125 2e-027 gb|AAG41774.1| Cat [Promoter probe vector pPR9TT] 125 2e-027 dbj|BAB32741.1| chloramphenicol acetyltransferase [Cloning ... 125 2e-027 gb|AAF86675.1| chloramphenicol transacetylase [Integration ... 125 2e-027 dbj|BAA03187.1| chloramphenicol acetyl transferase [synthet... 125 2e-027 gb|AAC53603.1| chloramphenicol acetyltransferase 125 2e-027 >emb|CAJ00344.1| chloramphenicol acetyltransferase [Aeromonas hydrophila] gb|AAB67677.1| choramphenicol acetyltransferase [Cloning vector pJB3Cm6] gb|AAS87172.1| chloramphenicol acetyltransferase [Achromobacter xylosoxidans] gb|AAK55328.1| chloramphenicol acetyltransferase [Cloning vector pALTER(R)*-MAX] gb|AAB39977.1| chloramphenicol acetyltransferase [Reporter vector pCAT3-Promoter vector] gb|AAB39975.1| chloramphenicol acetyltransferase [Reporter vector pCAT3-Enhancer vector] gb|AAB39973.1| chloramphenicol acetyltransferase [Reporter vector pCAT3-Control vector]
gb|AAB39971.1| chloramphenicol acetyltransferase [Reporter vector pCAT3-Basic vector]
gb|AAC53634.1| chloramphenicol acetyltransferase gb|AAC53624.1| chloramphenicol acetyltransferase gb|AAA72895.1| chloramphenicol acetyltransferase Length = 219 Score = 125 bits (315), Expect = 2e-027 Identities = 57/62 (91%), Positives = 57/62 (91%) Frame = -3
LNV NMD AP FTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG Sbjct: 158 LNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG 217
GA Sbjct: 218 GA 219 ------------------ gnl|ti|818421508 name:POAA-aaa27k24.b1 mate_pair:818423171 (264 letters) Score E
Sequences producing significant alignments: (bits) Value emb|CAC16463.1| putative secreted hydrolase [Streptomyces c... 52 8e-006 ref|XP_815596.1| hypothetical protein [Trypanosoma cruzi] >... 34 1.8 >emb|CAC16463.1| putative secreted hydrolase [Streptomyces coelicolor A3(2)] ref|NP_631626.1| putative secreted hydrolase [Streptomyces coelicolor A3(2)] Length = 633
Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +1
VG+G G +V GDHD+WRLPE DD L V GD Y + Sbjct: 264 VGLGSGGQEVRGDHDVWRLPEQDDRLTVRPGDPDYLL 300 ----------- gnl|ti|818423171 name:POAA-aaa27k24.g1 mate_pair:818421508 (642 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAC16463.1| putative secreted hydrolase [Streptomyces c... 57 4e-007 gb|AAK78893.1| and cellulose-binding endoglucanase family 9... 47 6e-004 Yüklə 3,49 Mb. Dostları ilə paylaş:
|