Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
|
ref|XP_466500.1| putative phosphate transporter 2-1 [Oryza ... 57 6e-007 ref|NP_189289.2| PHT2;1 [Arabidopsis thaliana] 57 6e-007 ref|NP_850633.1| PHT2;1 [Arabidopsis thaliana] >gi|1402876|... 57 6e-007 gb|AAN46087.1| phosphate transporter PHT2-1 [Medicago trunc... 57 8e-007 emb|CAD36013.1| phosphate hydrogen transporter [Spinacia ol... 57 8e-007 emb|CAE61873.1| Hypothetical protein CBG05853 [Caenorhabdit... 57 8e-007 gb|AAB41897.1| putative phosphate permease [Mesembryanthemu... 57 8e-007 >emb|CAG37357.1| probable phosphate permease [Desulfotalea psychrophila LSv54] ref|YP_066364.1| phosphate permease [Desulfotalea psychrophila LSv54] Length = 421 Score = 59.7 bits (143), Expect = 1e-007 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = -2
+ILL+ IVLGL TLGYRV+ T+G+KIT+L P +GF AE A + TV+ AS GL Sbjct: 307 WILLLGGAGIVLGLITLGYRVMLTVGKKITELTPSRGFCAELAAAITVVIASRTGL 362 ----------- gnl|ti|820219522 name:POAA-aaa58g21.b1 mate_pair:818420591 (479 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|ZP_00524327.1| Protein of unknown function DUF255 [Soli... 79 5e-014 ref|XP_420103.1| PREDICTED: similar to Transcript increased... 70 2e-011 ref|ZP_00531347.1| Protein of unknown function DUF255 [Chlo... 67 2e-010 ref|XP_393124.2| PREDICTED: similar to sperm protein SSP411... 67 2e-010 emb|CAF92441.1| unnamed protein product [Tetraodon nigrovir... 67 2e-010 gb|AAM07078.1| conserved hypothetical protein [Methanosarci... 66 5e-010 ref|XP_588684.2| PREDICTED: similar to sperm protein SSP411... 65 1e-009 ref|XP_886021.1| PREDICTED: similar to sperm protein SSP411... 65 1e-009 ref|XP_886001.1| PREDICTED: similar to sperm protein SSP411... 65 1e-009 ref|XP_885984.1| PREDICTED: similar to sperm protein SSP411... 65 1e-009 >ref|ZP_00524327.1| Protein of unknown function DUF255 [Solibacter usitatus Ellin6076] gb|EAM56638.1| Protein of unknown function DUF255 [Solibacter usitatus Ellin6076] Length = 898 Score = 79.0 bits (193), Expect = 5e-014 Identities = 39/73 (53%), Positives = 50/73 (68%) Frame = +3
+HT+ +TAEHF + + L N+ R LL R R RPHLDDKI+T+WNGLMISAFAKG Sbjct: 581 QHTLEQTAEHFGQPAGEMDATLDNAARILLQARAKRVRPHLDDKILTSWNGLMISAFAKG 640
AVL + Y + + Sbjct: 641 GAVLEEPRYAEAA 653 ---------- gnl|ti|818420594 name:POAA-aaa58i05.g1 mate_pair:820219525 (640 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAB33421.1| putative senescence-associated protein [Pis... 70 7e-011 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 62 2e-008 ref|XP_577589.1| PREDICTED: similar to LRRG00134 [Rattus no... 56 1e-006 gb|AAR25995.1| putative senescence-associated protein [Pyru... 54 5e-006 ref|XP_648070.1| conserved hypothetical protein [Entamoeba ... 53 9e-006 ref|XP_665229.1| senescence-associated protein [Cryptospori... 47 4e-004 ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 47 6e-004 gb|EAA18798.1| hypothetical protein [Plasmodium yoelii yoelii] 46 0.001 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 45 0.002 gb|EAA21327.1| putative senescence-associated protein [Plas... 44 0.005 >dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282
Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3
A P WW N TL EFCF+MIGRADIEGSKS+VAMNAW PQAS Sbjct: 72 AHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQAS 114 ------------- gnl|ti|818420627 name:POAA-aaa58o15.g1 (846 letters) Score E
Sequences producing significant alignments: (bits) Value gb|AAG17115.1| homogentisate 1,2-dioxygenase [Dictyostelium... 59 2e-007 ref|XP_638887.1| hypothetical protein DDB0191461 [Dictyoste... 59 2e-007 gb|EAA13786.3| ENSANGP00000021048 [Anopheles gambiae str. P... 59 2e-007 ref|XP_416553.1| PREDICTED: similar to Homogentisate 1,2-di... 58 4e-007 emb|CAF97989.1| unnamed protein product [Tetraodon nigrovir... 58 4e-007 gb|AAH55029.1| Homogentisate 1, 2-dioxygenase [Mus musculus] 56 2e-006 gb|AAH37628.2| Homogentisate 1, 2-dioxygenase [Mus musculus] 56 2e-006 ref|NP_038575.1| homogentisate 1, 2-dioxygenase [Mus muscul... 56 2e-006 ref|XP_573291.1| PREDICTED: homogentisate 1, 2-dioxygenase ... 56 2e-006 ref|NP_001012145.1| homogentisate 1, 2-dioxygenase (predict... 56 2e-006 >gb|AAG17115.1| homogentisate 1,2-dioxygenase [Dictyostelium discoideum] Length = 431
Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2
+RPPYFH NCMSEFMGLI G+YEAK+EGF P Sbjct: 326 FRPPYFHRNCMSEFMGLIRGVYEAKKEGFLP 356 Score = 53.5 bits (127), Expect = 9e-006 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -3 Query: 643 RRAFLPGGASLHSCMTPHEPDADTFAKASTADLK 542 + FLPGG SLHSCMTPH PD+DTF A A+LK Sbjct: 351 KEGFLPGGGSLHSCMTPHGPDSDTFYAAIKAELK 384 ----------------- gnl|ti|820220197 name:POAA-aaa59a08.b1 mate_pair:818419059 (707 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAC86379.1| unnamed protein product [Homo sapiens] 47 8e-004 dbj|BAA92648.2| KIAA1410 protein [Homo sapiens] 47 8e-004 ref|XP_516507.1| PREDICTED: similar to KIAA1410 protein [Pa... 47 8e-004 ref|NP_056327.3| dynein, axonemal, heavy polypeptide 1 [Hom... 47 8e-004 ref|XP_612278.2| PREDICTED: similar to dynein, axonemal, he... 46 0.001 gb|EAN79778.1| dynein heavy chain, putative [Trypanosoma br... 46 0.001 ref|XP_395072.2| PREDICTED: similar to CG7092-PA [Apis mell... 45 0.002 emb|CAB06069.2| axonemal dynein heavy chain [Mus musculus] 45 0.003 ref|XP_591199.2| PREDICTED: similar to axonemal dynein heav... 45 0.003 ref|XP_533802.2| PREDICTED: similar to dynein, axonemal, he... 45 0.003 >dbj|BAC86379.1| unnamed protein product [Homo sapiens] Length = 1205
Identities = 18/45 (40%), Positives = 29/45 (64%) Frame = -2
V + + +E F ++PL+ LRNPG+R+RHW LS+ +N + P Sbjct: 1080 VALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRP 1124 -------------- PP17_Resultat gnl|ti|818419091 name:POAA-aaa59g04.g1 mate_pair:820220226 (896 letters) Score E
Sequences producing significant alignments: (bits) Value dbj|BAD67019.1| laminarinase [Trichoderma viride] 58 4e-007 gb|AAL84694.1| beta-1,3-glucanase precursor [Hypocrea virens] 56 1e-006 gb|AAL84695.1| beta-1,3-glucanase precursor [Hypocrea virens] 53 2e-005 emb|CAD70430.1| probable GLUCAN ENDO-1, 3-BETA-GLUCOSIDASE ... 52 3e-005 ref|XP_324462.1| hypothetical protein [Neurospora crassa] >... 52 3e-005 gb|EAA75332.1| hypothetical protein FG11006.1 [Gibberella z... 48 4e-004 emb|CAG01157.1| unnamed protein product [Tetraodon nigrovir... 38 0.41 emb|CAA58889.1| endo-1,3(4)-beta-glucanase [Hypocrea lixii]... 37 1.2 >dbj|BAD67019.1| laminarinase [Trichoderma viride] Length = 759 Score = 58.2 bits (139), Expect = 4e-007 Identities = 29/58 (50%), Positives = 36/58 (62%) Frame = -1
GTW+H LGSEHWWLYQLN+ S ++ S L ++TNYDQ D TQ+ P A Sbjct: 592 GTWLHGLGSEHWWLYQLNL------RSASNVVVSLL----QSETNYDQGDNTQQVPPA 639 -------------------- gnl|ti|818419096 name:POAA-aaa59g14.g1 mate_pair:820220230 (909 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_715130.1| putative ubiquitin-like protein-specific p... 49 3e-004 ref|XP_715079.1| putative ubiquitin-like protein-specific p... 49 3e-004 emb|CAG07397.1| unnamed protein product [Tetraodon nigrovir... 48 5e-004 ref|NP_067640.2| SUMO1/sentrin/SMT3 specific protease 2 [Ho... 47 0.001 ref|NP_083733.1| SUMO/sentrin specific protease 2 [Mus musc... 47 0.001 emb|CAD39043.1| hypothetical protein [Homo sapiens] 47 0.001 gb|AAL14437.1| SUMO-1/Smt3-specific isopeptidase 2 [Mus mus... 47 0.001 gb|AAG34653.1| Axin-associating molecule [Rattus norvegicus... 47 0.001 gb|AAG15309.2| sentrin-specific protease [Homo sapiens] 47 0.001 sp|Q9HC62|SENP2_HUMAN Sentrin-specific protease 2 (Sentrin/... 47 0.001 >ref|XP_715130.1| putative ubiquitin-like protein-specific protease [Candida albicans SC5314]
gb|EAK96096.1| potential ubiquitin-like protein-specific protease [Candida albicans SC5314] Length = 491
Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = -2
P+Q G DCGVF RY+ N P+ ++Q M+IIR M YE++ Sbjct: 441 PQQKNGSDCGVFTCTAARYISANKPLSYSQNDMKIIRRRMVYEIL 485 ------------ gnl|ti|820220232 name:POAA-aaa59g18.b1 mate_pair:818419098 (720 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAG37357.1| probable phosphate permease [Desulfotalea p... 60 9e-008 ref|ZP_00141684.2| COG0306: Phosphate/sulphate permeases [P... 59 2e-007 ref|XP_466499.1| putative phosphate transporter 2-1 [Oryza ... 57 5e-007 ref|XP_466500.1| putative phosphate transporter 2-1 [Oryza ... 57 5e-007 ref|NP_189289.2| PHT2;1 [Arabidopsis thaliana] 57 5e-007 ref|NP_850633.1| PHT2;1 [Arabidopsis thaliana] >gi|1402876|... 57 5e-007 gb|AAN46087.1| phosphate transporter PHT2-1 [Medicago trunc... 57 6e-007 emb|CAD36013.1| phosphate hydrogen transporter [Spinacia ol... 57 6e-007 emb|CAE61873.1| Hypothetical protein CBG05853 [Caenorhabdit... 57 6e-007 gb|AAB41897.1| putative phosphate permease [Mesembryanthemu... 57 6e-007 >emb|CAG37357.1| probable phosphate permease [Desulfotalea psychrophila LSv54] ref|YP_066364.1| phosphate permease [Desulfotalea psychrophila LSv54] Length = 421
Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = -2
+ILL+ IVLGL TLGYRV+ T+G+KIT+L P +GF AE A + TV+ AS GL Sbjct: 307 WILLLGGAGIVLGLITLGYRVMLTVGKKITELTPSRGFCAELAAAITVVIASRTGL 362 ------------- gnl|ti|818419109 name:POAA-aaa59i16.g1 (910 letters) Score E
Sequences producing significant alignments: (bits) Value ref|XP_479446.1| putative xylose isomerase [Oryza sativa (j... 75 3e-012 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vu... 74 7e-012 emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vu... 74 7e-012 ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana] >g... 71 6e-011 gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana] 71 6e-011 ref|NP_851203.1| xylose isomerase [Arabidopsis thaliana] 71 6e-011 dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana] >gi... 71 6e-011 ref|XP_785507.1| PREDICTED: hypothetical protein XP_780414,... 68 5e-010 ref|YP_366061.1| xylose isomerase [Xanthomonas campestris p... 58 5e-007 gb|AAC95125.1| xylose isomerase [Lactobacillus brevis] >gi|... 57 9e-007 >ref|XP_479446.1| putative xylose isomerase [Oryza sativa (japonica cultivar-group)] dbj|BAC83596.1| putative xylose isomerase [Oryza sativa (japonica cultivar-group)] Length = 479
Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -2
V +WHT+R G DPFG T+ WP++DGT SL+ A R+RAHFEF++KLGV+ Sbjct: 89 VAFWHTFRGTGGDPFGAPTKSWPWEDGTNSLDMAKRRMRAHFEFMEKLGVD 139 Score = 47.4 bits (111), Expect = 7e-004 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = -3 Query: 269 YTFHDRDVAPEGQTWVQTTKFLDEVVAEAERLQKATGILQL 147 + FHDRD+AP+G+T +T K LDE+V A++LQ+ T I L Sbjct: 141 WCFHDRDIAPDGKTLTETNKNLDEIVELAKKLQEETNIKPL 181 -------------- gnl|ti|818419147 name:POAA-aaa59o22.g1 mate_pair:820220270 (927 letters)
Score E
Sequences producing significant alignments: (bits) Value emb|CAF97989.1| unnamed protein product [Tetraodon nigrovir... 65 4e-009 gb|AAG17115.1| homogentisate 1,2-dioxygenase [Dictyostelium... 62 3e-008 ref|XP_638887.1| hypothetical protein DDB0191461 [Dictyoste... 62 3e-008 ref|ZP_00241489.1| COG3508: Homogentisate 1,2-dioxygenase [... 62 3e-008 ref|ZP_00522927.1| Homogentisate 1,2-dioxygenase [Solibacte... 61 5e-008 ref|ZP_00503031.1| Homogentisate 1,2-dioxygenase [Polaromon... 61 6e-008 ref|YP_341824.1| Homogentisate 1,2-dioxygenase (Homogentisi... 61 6e-008 gb|AAH55029.1| Homogentisate 1, 2-dioxygenase [Mus musculus] 59 2e-007 ref|XP_573291.1| PREDICTED: homogentisate 1, 2-dioxygenase ... 59 2e-007 ref|NP_001012145.1| homogentisate 1, 2-dioxygenase (predict... 59 2e-007 >emb|CAF97989.1| unnamed protein product [Tetraodon nigroviridis] Length = 436 Score = 64.7 bits (156), Expect = 4e-009 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -1
GL G YEAK+EGF GGA LHS MTP GP+AD F K STA+LK +R G Sbjct: 344 GLIKGHYEAKEEGFQPGGASLHSIMTPHGPDADCFEKNSTAELKPERVADG 394 ------------ gnl|ti|818420358 name:POAA-aaa60j17.g1 mate_pair:820220862 (672 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|ZP_00323077.1| COG0667: Predicted oxidoreductases (rela... 69 1e-010 ref|YP_320629.1| Aldo/keto reductase [Anabaena variabilis A... 60 6e-008 ref|YP_327048.1| ABC transport system cluster protein (pred... 59 2e-007 gb|EAM75110.1| Aldo/keto reductase [Kineococcus radiotolera... 57 5e-007 ref|ZP_00524395.1| Aldo/keto reductase [Solibacter usitatus... 57 7e-007 ref|NP_465529.1| hypothetical protein lmo2005 [Listeria mon... 56 9e-007 ref|NP_883906.1| putative oxidoreductase [Bordetella parape... 56 9e-007 ref|YP_014622.1| oxidoreductase, aldo/keto reductase family... 56 9e-007 ref|ZP_00234235.1| oxidoreductase, aldo/keto reductase fami... 56 9e-007 ref|ZP_00375757.1| putative oxidoreductase [Erythrobacter l... 56 1e-006 >ref|ZP_00323077.1| COG0667: Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Pediococcus pentosaceus ATCC 25745] Length = 340 Score = 68.9 bits (167), Expect = 1e-010 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3
G APIIG+TK HL+DAVAA+ V+LTNDDV +LEE+Y PHPI G Sbjct: 279 GVTAPIIGSTKAKHLDDAVAALSVKLTNDDVKYLEEMYIPHPIVG 323 Score = 38.1 bits (87), Expect = 0.25 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +1 Query: 133 SGKVRYIGASSMWAWQFSKAQAIAERRGWAK 225 +GKVR IGAS+M+ +QF Q +A+ GWA+ Sbjct: 149 AGKVRAIGASAMYGYQFYNMQQVAKDHGWAQ 179 ------------------ gnl|ti|820220872 name:POAA-aaa60l19.b1 mate_pair:818420370 (792 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAM21201.1| VioB [uncultured bacterium] 50 1e-004 emb|CAC93715.1| hypothetical protein [Lechevalieria aerocol... 47 6e-004 ref|NP_902943.1| VioB - polyketide synthase [Chromobacteriu... 47 7e-004 gb|AAD51809.1| VioB [Chromobacterium violaceum] 47 7e-004 dbj|BAA84783.1| Vio B [Chromobacterium violaceum] 47 7e-004 dbj|BAC55211.1| CCA synthetase [Streptomyces sp. TP-A0274] ... 43 0.014 ref|XP_517048.1| PREDICTED: similar to pericardine [Pan tro... 35 2.9 ref|NP_965294.1| DNA polymerase III alpha subunit [Lactobac... 35 2.9 ref|YP_261157.1| bll2701 [Pseudomonas fluorescens Pf-5] >gi... 35 2.9 dbj|BAC92190.1| gll4249 [Gloeobacter violaceus PCC 7421] >g... 34 6.4 >gb|AAM21201.1| VioB [uncultured bacterium] Length = 1005
Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = -2
SL++Q YLYAA+S+P+Y+ + +G W +L L CG + + G RGTL+EI Sbjct: 621 SLMLQ-YLYAAYSIPNYEQGVQMVATGRWQAGELELACGGADRRRHSGARGTLLEI 675 Score = 38.9 bits (89), Expect = 0.20 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = -3 Query: 100 LAHQEMIHFLIANNLLMAAGGAFY 29 +AH+EMIH+L+ NN+LMA G FY Sbjct: 675 IAHEEMIHYLVVNNVLMALGEPFY 698 ----------- gnl|ti|820220872 name:POAA-aaa60l19.b1 mate_pair:818420370 (792 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAM21201.1| VioB [uncultured bacterium] 50 1e-004 emb|CAC93715.1| hypothetical protein [Lechevalieria aerocol... 47 6e-004 ref|NP_902943.1| VioB - polyketide synthase [Chromobacteriu... 47 7e-004 gb|AAD51809.1| VioB [Chromobacterium violaceum] 47 7e-004 dbj|BAA84783.1| Vio B [Chromobacterium violaceum] 47 7e-004 dbj|BAC55211.1| CCA synthetase [Streptomyces sp. TP-A0274] ... 43 0.014 ref|XP_517048.1| PREDICTED: similar to pericardine [Pan tro... 35 2.9 ref|NP_965294.1| DNA polymerase III alpha subunit [Lactobac... 35 2.9 ref|YP_261157.1| bll2701 [Pseudomonas fluorescens Pf-5] >gi... 35 2.9 dbj|BAC92190.1| gll4249 [Gloeobacter violaceus PCC 7421] >g... 34 6.4 >gb|AAM21201.1| VioB [uncultured bacterium] Length = 1005
Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = -2
SL++Q YLYAA+S+P+Y+ + +G W +L L CG + + G RGTL+EI Sbjct: 621 SLMLQ-YLYAAYSIPNYEQGVQMVATGRWQAGELELACGGADRRRHSGARGTLLEI 675 Score = 38.9 bits (89), Expect = 0.20 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = -3 Query: 100 LAHQEMIHFLIANNLLMAAGGAFY 29 +AH+EMIH+L+ NN+LMA G FY Sbjct: 675 IAHEEMIHYLVVNNVLMALGEPFY 698 ------------- gnl|ti|818423003 name:POAA-aaa61l06.b1 mate_pair:818421980 (565 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_760204.1| hypothetical protein UM04057.1 [Ustilago m... 65 2e-009 emb|CAB58730.1| SPAC513.07 [Schizosaccharomyces pombe] >gi|... 64 3e-009 ref|XP_663581.1| hypothetical protein AN5977.2 [Aspergillus... 63 5e-009 ref|XP_720744.1| putative oxidoreductase [Candida albicans ... 63 6e-009 gb|EAA68861.1| hypothetical protein FG01476.1 [Gibberella z... 62 1e-008 ref|XP_505847.1| hypothetical protein [Yarrowia lipolytica]... 62 1e-008 ref|XP_502514.1| hypothetical protein [Yarrowia lipolytica]... 61 2e-008 ref|XP_502741.1| hypothetical protein [Yarrowia lipolytica]... 59 7e-008 ref|XP_500625.1| hypothetical protein [Yarrowia lipolytica]... 59 7e-008 gb|EAL93323.1| ketoreductase [Aspergillus fumigatus Af293] ... 58 2e-007 >ref|XP_760204.1| hypothetical protein UM04057.1 [Ustilago maydis 521] gb|EAK84982.1| hypothetical protein UM04057.1 [Ustilago maydis 521] Length = 350 Score = 64.7 bits (156), Expect = 2e-009 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +3
P VYT WNP++YEDA K GA Y SK LAEKAAWD++ EKPH+ I+ +P Sbjct: 142 PGFVYTADCWNPSSYEDAIKAGGA--GAFSYSVSKKLAEKAAWDYLANEKPHFEIACINP 199 ------------- gnl|ti|818421982 name:POAA-aaa61l10.g1 mate_pair:818423005 (793 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_641655.1| hypothetical protein DDB0205796 [Dictyoste... 66 2e-009 gb|AAD38254.1| similar to translational activator [Arabidop... 62 3e-008 ref|NP_176659.2| unknown protein [Arabidopsis thaliana] 62 3e-008 gb|AAM47299.1| unknown protein [Oryza sativa (japonica cult... 59 1e-007 gb|AAX95705.1| HEAT repeat, putative [Oryza sativa (japonic... 59 1e-007 gb|AAT77858.1| putative translational activator [Oryza sati... 59 1e-007 gb|AAW41861.1| regulation of translational elongation-relat... 55 3e-006 gb|EAA46127.2| CG17514-PA.3 [Drosophila melanogaster] >gi|6... 55 4e-006 gb|EAL38547.1| ENSANGP00000029378 [Anopheles gambiae str. P... 53 1e-005 gb|EAA00880.2| ENSANGP00000008519 [Anopheles gambiae str. P... 53 1e-005 >ref|XP_641655.1| hypothetical protein DDB0205796 [Dictyostelium discoideum] gb|EAL67682.1| hypothetical protein DDB0205796 [Dictyostelium discoideum] Length = 2667 Score = 65.9 bits (159), Expect = 2e-009 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2
++GMGEE FSTLI W+LET++SD G+VERSGAAQGLS+VL Sbjct: 1684 VRGMGEENFSTLIPWLLETVKSDQGAVERSGAAQGLSEVL 1723 Score = 52.0 bits (123), Expect = 2e-005 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = -3 Query: 701 LLDRGLRDRGTETKKRAAQIVGNMCSLTDPHELIPYL 591 +L+R L++R +E KK + QIVGN+CSLT+P +L+PYL Sbjct: 1618 ILERTLKERSSELKKMSCQIVGNLCSLTEPKDLVPYL 1654 ------------ gnl|ti|818423010 name:POAA-aaa61l22.b1 mate_pair:818421988 (907 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|NP_001016800.1| 24-dehydrocholesterol reductase [Xenopu... 167 5e-040 ref|NP_001026459.1| 24-dehydrocholesterol reductase [Gallus... 166 1e-039 gb|AAH74393.1| MGC84360 protein [Xenopus laevis] 166 1e-039 emb|CAG10929.1| unnamed protein product [Tetraodon nigrovir... 166 1e-039 gb|AAH78029.1| Dhcr24-prov protein [Xenopus laevis] 165 2e-039 ref|XP_613218.2| PREDICTED: similar to 24-dehydrocholestero... 165 2e-039 gb|AAP36155.1| Homo sapiens 24-dehydrocholesterol reductase... 165 2e-039 dbj|BAA02806.3| KIAA0018 protein [Homo sapiens] 165 2e-039 dbj|BAD51990.1| 24-dehydrocholesterol reductase [Macaca fas... 165 2e-039 sp|Q60HC5|DHC24_MACFA 24-dehydrocholesterol reductase precu... 165 2e-039 >ref|NP_001016800.1| 24-dehydrocholesterol reductase [Xenopus tropicalis] Length = 516
Identities = 86/174 (49%), Positives = 116/174 (66%), Gaps = 3/174 (1%) Frame = -3
L +G L I +LW F Y++ HHR V F+LP+S +FD+Y+ AR W + K+ S Yüklə 3,49 Mb. Dostları ilə paylaş:
|