T. C. BİLeciK Şeyh edebali ÜNİversitesi fen edebiyat faküLtesi moleküler biyoloji ve genetik böLÜMÜ



Yüklə 197.04 Kb.
tarix18.01.2018
ölçüsü197.04 Kb.

c:\users\acer\desktop\adsız.png

T.C.

BİLECİK ŞEYH EDEBALİ ÜNİVERSİTESİ

FEN EDEBİYAT FAKÜLTESİ

MOLEKÜLER BİYOLOJİ VE GENETİK BÖLÜMÜ

HÜCREDE Kİ EŞSİZ DEPOCUKLAR: FERRİTİN PROTEİNİ

HAZIRLAYAN

Şeyma AKARSU

17765230764

Dersin Öğretim Üyesi

Yrd. Doç.Dr. Dilek ÜNAL ÖZAKÇA



Dersin Kodu Ve Adı

MBG-301/Biyokimya-I

ARALIK 2012-BİLECİK

HÜCREDE Kİ EŞSİZ DEPOCUKLAR: FERRİTİN PROTEİNİ

ÖZET

Ferritin vücut içinde demir depolamada çok önemli bir rol oynayan proteindir. H ve L olmak üzere 2 alt birimi vardır. Yapılan araştırmalarda tüm canlılarda son derece korunduğu bulunmuştur. Son zamanlarda yapılan Ferritin ile ilgili araştırmalarda ateroskleroz, kanser, nöropsikiyatrik bozukluklar gibi hastalıkların patogenezinde çok önemli bir etken olarak ortaya çıkmaktadır. Prooksidant ve Proinflamatuar yollar gibi bir dizi mekanizmadan sorumludur. Ferritin demir depolamanın yanında vücutta çeşitli işlevleri gerçekleştirir. Birçok proteinin regülasyonundan sorumludur. Ferritin yapısı ve konsantrasyonunda meydana gelen değişiklikler birçok hastalığın oluşmasına etkendir. Bu derlemede ferritin molekülünün moleküler yapısı, fonksiyonları, diğer moleküllerle ilişkisi, hangi canlılarda bulunduğu ve canlılarda ki farklılıkları ve neden olduğu hastalıklar anlatılacaktır.



Anahtar kelimeler: ferritin, demir, ferrihidrit, hemoglobin, Mycobacterium tıuberculosis

Kimyasal Sistem Olan Vücut: Vücudu Süsleyen Kimyasal Elementler

Vücudumuz neyden yapılmış ve bunlar nasıl çalışır? Bu soru birçok kimyager, biyolog ve mühendisler için en temel konudur. Vücudumuz canlılığımızı sürdürmede rol oynayan moleküller ve büyük yapılar üretmek için özel olarak düzenlenmiştir. Bir atomun özelliği başka atomlar ile nasıl etkileşim kuracağını belirler. Buna bağlı olarak moleküllerin özellikleri ve reaksiyonlar atomların etkileşimlerine bağlıdır.

Bir kimyasal sistem olan insan vücudunun tartışması "Vücut ne tür atomları içerir? "sorusunu cevaplayarak başlar. Bugün yüzden fazla kimyasal element bilim adamları tarafından biliniyor, ancak bu elementler nispeten çok az sayıda insan vücudunda bulunmaktadır. Aslında sadece 24 elementin insan vücudu için gerekli olduğu düşünülür. Civa gibi diğer elementler bazen vücutta bulunabilir ancak bilinen gerekli ve faydalı işlevi gerçekleştirmezler. Vücudun en temel bileşenleri: oksijen (% 65), karbon (% 18), hidrojen, (% 10) ve azot (% 3)’dur. Kalsiyum, fosfor, demir, bakır, vücuttaki diğer elementler, fizyologlar tarafından mineral madde ve iz elementler olarak bilinir. Bu elementler, oksijen, karbon, hidrojen ve azota göre vücudun çok daha küçük bir yüzdesini oluşturmasına rağmen, mineral ve iz elementler vücudun düzgün işlemesi için hayati öneme sahiptir. Bu elementler vücutta uygun miktarda bulunmalıdır, bazı reaksiyonlara katılmak ve kritik molekülleri oluşturmamak için diğer elementlerle reaksiyona girerek bulunmalıdır.

Demir vücudun kütlesinin sadece % 0.008‘ni (75kg olan yetişkin bir erkek için yaklaşık 6 gr) oluşturmasına rağmen vücudumuzdaki bu önemli unsur olmadan yaşayamayız.

VÜCUTTA DEMİRİN ÖNEMLİ ROLÜ

Demir hem grubunun merkez atomudur, metal kompleksi akciğerlerde moleküler oksijeni (O2) bağlar ve taşır, vücuttaki tüm hücreler faaliyetlerini gerçekleştirmek için oksijene ihtiyaç duyarlar. Demir olmadan hem grubu, oksijeni bağlayacak alana sahip olamaz, böylece hücrelere oksijen götürülemez ve hücrelerin ölümüne neden olunur.

Hemoglobine ek olarak, hemoglobinden oksijeni alıp ve oksijeni kas hücreleri boyunca diffüze eden miyoglobin ve enerji birikimi ile vücudun kaynağı olan sitokromlarda demir içerir.

Aynı zamanda DNA sentezi ve hücre bölünmesi için gerekli olan proteinlerde demiri kullanır. Ayrıca, demir vücudumuzdaki bağ dokuların, beynimizdeki nörotransmitterlerin üretilmesine yardımcı olur ve bağışıklık sistemini korumak için kullanılır



DEMİR BOZUKLUKLARI

Hemoglobin ve diğer moleküller düzgün çalışmak için demire bağlıdır, bu nedenle demir miktarının ayarlanması çok önemlidir. Günlük aktivitelerle, terleme, idrara çıkma, dışkılama, ile demir çok az miktarda kaybedilmektedir. Özellikle kadınlar menstrual dönemde çok fazla demir kaybeder. Demirin bu kayıplarını önlemek ve yeterli miktarda olması için günde yaklaşık 18mg demir üretmekteyiz.

Ağır kanama ve gebelik de dahil olmak üzere belirli koşullarda demir fazla tüketildiği için gereksinimi artmaktadır. İyi besin kaynakları kırmızı et, karaciğer, yumurta sarısı, fasulye, fındık ve güçlendirilmiş tahıllar da demir bol miktarda vardır.

Vücutta mevcut demirin kaynağı çok düşük olduğunda, demir eksikliği sonucu olarak bilinen durum ortaya çıkar. Demir eksikliği olan insanlar hemoglobini yeterli miktarda üretemez. Vücudun oksijen taşıma ihtiyaçlarını karşılayamazlar. Eksikliği ciddi durumda olduğunda demir eksikliği anemisi ortaya çıkar.

Demir eksikliği anemisinin en sık görülen belirtileri yorgunluk ve halsizlik (vücuttaki hücrelerde yetersiz oksijen olması nedeniyle), el ve göz kapaklarında solgunluktur (kırmızı renkli olan oksijenlenmiş hemoglobin düzeylerinde azalmaya bağlı). Demir eksikliği anemisi demir preparatlarıyla tedavi edilebilir ve demirin vücutta ki emilimini arttıracak stratejiler uygulanır.( vitamin c,demir emilimini arttırmak, ancak süt emilimini sınırlamak gibi.)

Buna karşın vücutta çok fazla demir birikebilir, bu durum aşırı demir olarak bilinir, aşırı demir şiddetli hale gelirse hemakromatosis tanısı konur. Hemakromotoz karaciğer sirozu, kalp yetmezliği, diyabet, karın ağrısı, arthrit olmak üzere vücut dokularında ciddi hasara neden olabilir.

Buradan yola çıkarak demirin azlığının veya çokluğunın hayati öneme sahip olduğu söylenebilir. Peki, vücudumuz bu önemli molekülün seviyesini nasıl düzenler?

FERRİTİN: DEMİR DEPOLAMA BİRİMİ

Vücudumuz mevcut demirin uygun miktarda ki düzeyini koruyabilir Demir tüketimimiz her zaman vücudun demir kaybı ile uyumlu olmaz. Ferritin (figür1) vücutta mevcut demirin miktarının önemli kontrol anahtarıdır. Ferritin her canlıda bulunan ve yüksek derecede korunmuş demir depolayan ve demiri kontrollü bir şekilde serbest bırakan bir proteindir. Bu nedenle vücutta demir eksikliğine karşı bir tampon görevi görür. Kanda çok az demir varsa Ferritin demiri fazla serbest bırakır, eğer çok fazla demir varsa daha az ölçüde serbest bırakır.




Demir Ferritin içinde mineral olarak depolanır

Figür 1

Ferritinin 3 boyutlu gösterimidir, ferritin küresel bir şekle sahiptir ve demir (kahverengi) kürenin içinde mineral olarak depolanır. Bu proteinin yapısı X Işını kristalografisiyle tespit edilmiştir.
c:\users\acer\desktop\adsız.png


Figür:2

Ferritin L zinciri moleküler grafiği ve etkileşimleri


http://www.ncbi.nlm.nih.gov/structure/mmdb/mmdbimage.fcgi?uid=40396&type=1&unm=1 http://www.ncbi.nlm.nih.gov/structure/mmdb/mmdbimage.fcgi?uid=40396&type=2&unm=1

Ferritin ailesi 3 alt aileden oluşmaktadır; ökaryot ve prokaryotların her ikisinde bulunan tipik demir saklayan ferritin (FTn), hem içeren bakterioferritin (Bfr), sadece prokaryotlarda bulunan DNA protein bağlayıcı olan starved hücreleri (DPs). Bu üç ferritin ailesinin de 3 boyutlu kristal yapısı şu canlılarda bulunmuştur; insan [1,2] kurbağa [3-4-5], at [6,7], soya fasulyesi [8], böcek [9], Escherichia coli [10], Campylobacter jejuni, Pyrococcus furiosus [11], Archaeoglobus fulgidus [12], Helicobacter pylori [13], Thermotoga maritima, Listeria innocua [14], Desulfovibrio desulfuricans [15], Bacillus brevis [16] ve diğerleri.

Primer dizilerinde ki önemli farklılıklara rağmen çeşitli ferritinlerin tersiyer ve quartarner yapılarında çarpıcı benzerlik bulunmuştur. [Figür3]


Figür-3

A)Mtb BfrB alt birim: yeşil B)Mtb BfrB alt birim archaea ve Eubacteria’dan gelen ferritinlere eklenmiştir: Campylobacter jejuni-cyan, Escherichia coli-eflatun, Pyrococcus furiosus sarı, Archaeoglobus fulgidus-pembe, Helicobacter pylori-zeytin yeşili, Thermotoga maritime-mavi mor. C)Ökaryotik memeli ferritinlerinden insan ferritinleri karıştırılmış, İnsan H ferritini-turuncu, İnsan mitokondriyal ferritini-açık yeşil,at dalağı L ferritini-pembe,fare L ferritini-hardal sarısı, D) ökaryotik memeli olmayan soya ferritini -mavi,ve böceklerde ki H-raspberry ve L-orman yeşili atbirimlerin uzantıları karıştırılmıştır.E) Mtb BfrA alt birimi F)Mycobacterium smegmatis'in Dps1-kahverengi ve Dps2 -buğday rengi alt birimleri karıştırılmıştır. doi:10.1371/journal.pone.0018570.g005


FERRİTİNİN YAPISI

Omurgalılarda sitozolde bulunan ferritin H (heavy,21kD) ve L (light 19kD) olarak adlandırılan 2 alt üniteden oluşur. Hücrenin fizyolojik durumuna ve doku tipine bağlı olarak ferritinde H ve L alt birim oranı değişebilir, karaciğer de L alt birim ağırlıklı iken, kalp ve böbrekte H ağırlıklıdır [17]. H ve L oranı sabit değildir fakat oldukça esnektir, iltihabik ve enfeksiyonlu durumlarda, ksenobiyotik strese yanıtta, farklılaşma ve gelişimsel geçişler gibi uyaranlarla değişebilir.

Ferritin de ki H ve L alt birimler farklı genlerde kodlanır [18-19]. Tekli fonksiyonel bir H ve L geninin tüm omurgalı türlerinde eksprese edildiği düşünülmüş olmasına rağmen, fonksiyonel bir mitokondriyal Ferritin geni son zamanlarda tanımlanmıştır [20].

Ferritin H; feroxidaz aktivitesiyle demiri oksitleyerek Fe(III) formuna dönüştürür. Ferritin L ise, demirin mineralizasyonundan ve uzun süre depolanmasından sorumludur [21].



Moleküler gösterimi ve Protein Yapısı

Proteinlerin 3 boyutlu yapıları biyolojik sistemde önemli roller oynamalarına izin verir, Ferritinin görevini nasıl yerine getirdiğini anlamak ve yapısal özellikleri ve molekülün fonksiyonu arasındaki ilişkiyi anlamak için molekülün 3 boyutlu yapısını görselleştirmek gerekir.

Burada Ferritinin, 2D-ChemDraw, Stick, CPK ve Şerit (bu sıraya göre) yapıları gösterilmiştir:

http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/alphahelix_cd.jpghttp://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/alphahelix_stick.jpghttp://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/alphahelix_cpk.jpghttp://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/alphahelix_ribbon.jpg

Bu gösterimde karbon atomları gri(siyah),azot atomları (mavi), oksijen atomları (kırmızı) gösterilmiştir. Hidrojen atomları 2D-ChemDraw da gösterilmiş (açık mavi) diğerlerinde gösterilmemiştir.

Bu şekillere bakarak her birinin aslında bize farklı şeyler söylediğini görebiliriz [Tablo1]. Örneğin alfa sarmal içinde ki atomların nasıl bağlandığı görülmek isteniyorsa 2D-ChemDraw veya stick kullanılır.

Gösterim tipi

Gösterimin

açıklanması



Gösterimin

sunduğu iyi özellikler



Dezavantajlar

2D-ChemDraw

Etiketli atomlar ve atomları bağlayan bağlar düz bir gösterimde gösterir.

Küçük moleküllerle atomlar arasında ki bağlantı ayrıca elektron çiftini içerebilir.

Molekülün 3 boyutlu yapısı hakkında iyi bir fikir vermez. Büyük molekülleri yorumlamak zordur

Stick

Her bir atom farklı renkle gösterilmiştir.

Atomlar arasında ki bağlantı molekülün 3 boyutlu yapısı hakkında fikir verir.

Kendisini oluşturan moleküllerin büyüklüğü hakkında bilgi vermez

CPK

Yarıçapları 3 boyutlu küre şeklinde olan atomların gösterimi.

Molekülün 3 boyutlu şekli, oluşturan atomların hacmi hakkında iyi fikir verir.

Molekül içinde ki tüm atomları ve bağlarını görmek zordur.

Şerit

Alfa heliks yapıda ki omurga şekli gösterilmiştir.

Proteinin ikincil yapısını gösterir.

Bireysel atomlar ve diğer önemli özellikler gösterilmez.

Tablo 1

PROTEİN YAPISI


Tablo-2

CGGCCGGCCGCCCATAGCCAGCCCTCCGTCACCTCTTCACCGCACCCTCGGACTGCCCCAAGGCCCCCGCCGCCGCTCCAGCGCCGCGCAGCCACCGCCGCCGCCGCCGCCCTCTCCTTAGTCGCCGCCATGACGACCGCGTCCACCTCGCAGGTGCGCCAGAACTACCACCAGGACTCAGAGGCCGCCATCAACCGCCAGATCAACCTGGAGCTCTACGCCTCCTACGTTTACCTGTCCATGTCTTACTACTTTGACCGCGATGATGTGGCTTTGAAGAACTTTGCCAAATACTTTCTTCACCAATCTCATGAGGAGAGGGAACATGCTGAGAAACTGATGAAGCTGCAGAACCAACGAGGTGGCCGAATCTTCCTTCAGGATATCAAGAAACCAGACTGTGATGACTGGGAGAGCGGGCTGAATGCAATGGAGTGTGCATTACATTTGGAAAAAAATGTGAATCAGTCACTACTGGAACTGCACAAACTGGCCACTGACAAAAATGACCCCCATTTGTGTGACTTCATTGAGACACATTACCTGAATGAGCAGGTGAAAGCCATCAAAGAATTGGGTGACCACGTGACCAACTTGCGCAAGATGGGAGCGCCCGAATCTGGCTTGGCGGAATATCTCTTTGACAAGCACACCCTGGGAGACAGTGATAATGAAAGCTAAGCCTCGGGCTAATTTCCCCATAGCCGTGGGGTGACTTCCCTGGTCACCAAGGCAGTGCATGCATGTTGGGGTTTCCTTTACCTTTTCTATAAGTTGTACCAAAACATCCACTTAAGTTCTTTGATTTGTACCATTCTTCAAATAAAGAAATTTGGTACCCAGGTGTTGTCTTTGAGGTCTTGGATGAATCAGAAATCTATCCAGGCTATCTTCCAGATTCCTTAAGTGCCGTTGTTCAGTTCTAATCACACTAATCAAAAAGAAACGAGTATTTGTATTTATTAAACTCATTAGTTTGGGCAGTATACTAAGGTGTGGCTGTCTTGGATTCAGATAGAACTAAGGGTTCCCGACTCTGAATCCAGAGTCTGAGTTAAATGTTTCCAATGGTTCAGTCTAGCTTTCACAGTTTTTATGAATAAAAGGCATTAAAGGCTG



Ferritin Nükleik asit Sekansı
Aminoasitleri oluşturmak da atomların nasıl dizildiğine bakmak için 2d-ChemDraw gösterimi kullanılmıştır. Daha sonra aminoasitlerin oluşturduğu peptitler olarak bilinen protein alt birimlerini nasıl oluşturduğunu anlamak için tüm gösterimler kullanılmıştır. Son olarak ferritin, içi boş küre şekli ve kanalları oluşturmada 24 peptid alt birimini nasıl birleştirildiğini göstermek için Şerit ve CPK gösterimi kullanılmıştır.Tablo2 ve Tablo3 te Ferritin proteinin nükleik asit dizi ve aminoasit sekansı verilmiştir.


Tablo-3

>gi|306744|gb|AAA35832.1| ferritin [Homo sapiens]

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL

MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN

EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES

Ferritin Aminoasid Sekansı


Ferritinin 24 peptit alt birim topluluğu

Ferritin içi boş bir küresel kabuktan oluşur(şekil-6). 24 peptit alt birimi (Şekil 4-5) bir araya gelerek apoferritin kabuğu oluşturur.




Figür 5

Protein veya peptit omurgasının izlenmesinde her ikisininde ortak gösterimi olan ribon(kurdele) gösterimi verilmiştir.

Bu gösterim yan zincirler kalıntısı olan atomları içermez ve genellikle üç boyutlu bir yapıyı temsil etmek için kullanılır
http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/peptide_cpk.jpghttp://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/peptide_ribbon.jpg


Figür 4:Bu ferritin proteini içinde bir peptit zincirinin moleküler modelidir, CPK gösterimi ile gösterilmiştir. Bu gösterimde ağır atomların hepsi gösterilir(H atomları gösterilmez). Atom yarıçapları wandervals yarıçaplarına eşit olarak gösterilir.Not: C atomları gri(siyah),azot atomları mavi, oksijen atomları kırmızı olarak gösterilmiştir.



4lü alt birimler 4 katlı kanalın duvarları koyu mavi şekilde gösterilmiştir,3 katlı kanallar, eflatun, açık mavi ve koyu mavi kesişiminde oluşmuştur.

Figür 6

Bu Ferritinin CPK gösteriminde ki moleküler modülüdür. CPK gösteriminde küreler atomları temsil eder. Her kürenin yarıçapı atomun van der Waals yarıçapına eşittir. Dolayısıyla CPK temsilleri bir molekül tarafından kaplanan yaklaşık hacmi göstermek için iyi bir yoldur.24 alt birimlerin tümü özdeştir, ancak yapıyı göstermek için renklerle kodlanmışlardır, merkeze en yakın koyu mavi alt birimler, eflatun alt birimler uzak ve açık mavi alt birimleri en uzakta bulunmaktadır.


http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/ferritin_cpk.jpg

Oluşturduğu kürenin çapı yaklaşık 80 Angstrom olup duvarlar yaklaşık 10 Angstrom kalınlığındadır. Ferritin molekül ağırlığı 474.000 g / mol dür. Kürede kanallar 3 veya 4 polipeptit alt biriminin kesişmesiyle meydana gelir. Bu kanallar Ferritinin yeteneği olan kontrollü bir şekilde demiri serbest bırakmak için çok önemlidir.

Ferritin de 2 tip kanal bulunur. 4 katlı kanal 4 peptit alt biriminin kesiştiği noktada oluşur.(Figür 6’ nın merkezinde gösterildiği gibi.) 3 katlı kanal 3 peptit alt biriminin kesiştiği noktada oluşur.(Figür 6’ nın çevresinde gösterildiği gibi.).Bu iki kanal farklı kimyasal özelliklere sahiptir ve bu nedenle farklı fonksiyonları vardır. Daha sonra bu kanallara değinilecektir.

Ferritinin Hücrede ki Rolü

Hücre ve organizmada Ferritinin kritik rolü demir homeostazisidir. Hem molekülünde demir; oksijenin taşınması, bağlanması ve serbest kalması açısından gereklidir; Hem molekülü ile demirin birleşmesi organizmanın yaşaması için gereklidir.

Demir enzimlerin fonksiyonları içinde önemlidir. Hücre döngüsü, elektron taşıma gibi birçok önemli süreçte rol oynar. Ancak demire bağlı elektronlar süper oksit radikal üretimi için ve fenton reaksiyon yoluyla hidroksil radikallerinin üretimine katılabilirler.

[Fe (II) +H2O2 3 Fe (III) + OH¯ + OH] [22]

Hücresel sistemlerde demir toksisitesi, DNA, RNA, proteine doğrudan zarar verebilir. Bu yüzden hücrede Ferritin demir homeostazında önemli rol oynar. Ayrıca demir akışının düzenlenmesine ilaveten, hücresel Ferritin üzerinde ki etkiside önem kazanmıştır(tablo4). Gerçekte, Ferritin sadece transferin ve transferrin reseptörü gibi demir düzenleyici proteinlerin bir parçası olarak değil aynı zamanda stres ve inflamasyona karşı hücresel savunmayı düzenleyen bir protein ailesinin de üyesidir.[23].

Mekanizma

Efektörü


Transkripsiyonel regülasyon

TNF, cAMP, hematopoetik farklılaşma, demir oksidatif stres, kemopreventif ajanları, c-myc, E1A

IRP proteinlerin modülasyonu yoluyla post transkripsiyonel düzenleme

Demir, forbol ester, nitrik oksit, süper oksit ve hidroksil radikalleri, hipoksi-reoksijenasyon

mRNA stabilitesi ve protein kararlılığı dahil olmak üzere bağımsız IRP post transkripsiyonel düzenlenmesi

IL-1, forbol ester, hem

İntrasellüler lokalizasyonlardan demir bırakılması (ferritin kendisi de dahil) "ikincil" demir düzenlemesi

Oksidant stres (GSH azalması, menadion)

Tablo4

Serum Ferritini

Ferritin az miktarda insan serumunda bulunur ve aşırı demir yükü ve inflamasyonunda yükselir [24-25] .Serum ferritini demirden yoksundur, Ferritin L ye immünolojik olarak benzer, yeni bir G (glikosilatlı) alt birimi içerir [26]. Serum Ferritinin yaygın kullanımına rağmen, vücuttaki demir depolarının klinik göstergesi olarak çok az demir kaynağı bilinmektedir. Bununla birlikte, ferritin L mutasyonu olan hastalarda serum Ferritin arttırmayacağını, aynı genin ürününden Ferritin L ve serum ferritini türetildiği fikrini doğurmuştur.[27]



Ferritinden Demir Salınımı

Ferritin merkezinde ki demir, [FeO(OH)]8[FeO(H2PO4)] kimyasal formülüne sahip katı kristal olarak Fe+3 şeklinde depolanır. Ferritin merkezinde ki en iyi model mineral ferrihidrit’dir. (Figür7a- Figür 7b). Ferrihidrit mineralinde (Figür 7b), Her Fe (III) iyonu altı O(II) iyonlarıyla koordine edilir. Ancak ferritinde, çekirdekte ki mineral Fe(III) iyonunun yaklaşık %10’u 5O(II) ve 1 fosfat grubuna sahiptir. Fosfat grupların çoğu, demir iyonları için, kristal yapı dışında koordine çalışır, Ferritin kabuğunun (protein), iç kısmı da mineral kalıntılarını bağlamak için kullanılır.



Örgü sağlam kaldığı sürece, örgüde ki atomlar, çözünemezler. Böylece demirin sırayla ferritinden çıkması için mineral örgü çözülmüş olmalıdır. Ve demir Fe(III)’den Fe(II)’ ye gelmiş olmalıdır. Fe(II) de, Fe+2 iyonu olarak örgüden çıkar, Fe+2 iyonlarının pozitif yükü, suyun elektronegatif oksijen atomları tarafından çekilir ve iyon etrafında bir su kafesi oluşur. Böylece demir, sulu Fe+2 iyonları olarak çözünür hale gelir, Fe(H2O)62+, ve Ferritin proteininde ki küresel kabuk kanallardan serbest bırakılabilir.


Figür:7a
http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/unitcell.jpg

http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/mineral.jpg

Figür 7b

Ferritin Fe(III) minerali [FeO(OH)]8[FeO(H2PO4)] olarak depolanır. Bu mineral ferrihidrit, FeO(OH) (yukarıda gösterilen) ile temsil edilebilir. Not: [FeO(OH)]8[FeO(H2PO4)] ve FeO(OH) her ikisi içinde ferrihidrit adı kullanılır. Şekil 7de ferrihidrit minerali için birim hücre (yinelenen birim) gösterilmektedir. Not: Demir (III) iyonlarını kahverengi ve oksijen (II) iyonları kırmızı gösterilmiştir. Hidrojen atomları bu şekilde gösterilmemiştir Böylece siyah beyaz olarak birim hücre ayrıt edilebilir. Şekil 7b ferrihidritinin kristal örgü yapısını gösterir.






Ferritinde ki Kanallar

Çözünen demir, Ferritin kabuğundan nasıl ayrılır?

Ferritin kabukta 3 kat ve 4 kat olan 2 tip kanal bulunur. Üçlü kanallardan çözünmüş Fe+2 iyonu çıkar (figüre9). Bu kanalların polarite olarak bilinen özel bir özelliği vardır ki bu, kanallardan Fe+2 iyonlarının geçişini sağlar. Polarite bir molekül içinde bitişik atomlar arasında ki anlamlı elektronegatiflik farklılıkları gösterir.

Örneğin bir oksijen atomundan oluşan hidroksil grubu yüksek elektronegativiteye sahip, kovalent olarak H atomuna bağlanır, çünkü H atomunun elektronegativitesi düşüktür, bu bağlanmadan sonra moleküllerde polarite oluşur.

Ferritin de ki üç katlı kanal polar amino asitler olan Aspartat (Asp) ve Glutamat (Glu) ile kaplıdır [figüre10]. Polar a.a yan zincirleriyle kaplı olduğundan,3 katlı kanalın polar olduğu söylenir. Kanalın polaritesi, Fe+2 iyonları ile suyun birleşimini sağlar. Çünkü pozitif yüklü iyon, yan zincirlerin negatif kutupları tarafından çekilir [figüre8]. Fe+2’nin olumlu etkileşimi kanaldan geçmesini sağlar.



http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/polarity.jpg

Figür 8

Bu diyagram, su molekülleri ile aspartat molekülünün polar yan zincirlerinin etkileşimini gösterir



Fe+2 muhtemelen, bu kanalı geçerken hidrat kompleksinin 6 su molekülü ile geçmez. Çünkü, tüm bu kompleks kanala sığmayacak kadar büyüktür. Büyük ihtimalle, Fe+2 Ferritin kabuğunun içinden dış kısmına geçerken bazı su molekülleri ve bazı polar zincirler tarafından kaplanan kanal ile koordine edilir.

Kabuğun dışında daha sonra Fe+2 altı su moleküllerini yeniden kazanır ve tekrardan Fe(H2O)62+ hale gelir.



http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/3fold.jpg

http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/asp_glu.jpg

Figür 9

Bu ferritin proteininde üç katlı (polar) kanalının bir moleküler gösterimidir.



Figür 10

Bu diyagram ferritinde 3 katlı kanalda bulunan aspartat ve gtumatın 2D-ChemDraw gösterimidir. Yan zincirler yeşil ile gösterilmiştir.




Ferritin kanalının bir diğeri ise 4 katlı kanaldır [figüre11]. Bu kanallar apolar amino asit olan lösin ile kaplıdır [figüre12]. Lösinin yan zinciri yalnızca karbon ve hidrojen atomları içerir ki bunlar benzer elektronegativiteye sahiptir. Böylece, dört-katlı kanal non-polar olarak kabul edilir. Bu kanal apolar olduğundan bu kanalın FeII iyonu ile olumlu etkileşim yoktur ve Fe+2 bu kanallar aracılığıyla Ferritin kabuktan bırakılmaz.

Bu kanalların elektron transfer bölgesi olarak işlev gördüğü düşünülmektedir, mineral örgü içinde, Fe (III) vasıtasıyla Fe (II) indirgenir. Ancak bu elektron transfer mekanizması iyi anlaşılmamıştır.



http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/4fold.jpg

http://www.chemistry.wustl.edu/%7eedudev/labtutorials/ferritin/images/leu.jpg

Figure 11

Bu, ferritin proteininde dört katlı kanalın(nonpolar) moleküler gösterimidir. Elektronlar bu kanal üzerinden mineral örgüde Fe III’den Fe II’ ye aktarılır.




Figure 12

Bu lösinin (Leu) 2D-ChemDraw gösterimidir, non-polar aminoasit olduğundan ferritinin dört katlı kanalında bulunur. Yan zincir yeşille gösterilmiştir. Peptitte sadece yan gruplarının polarite de etkili olduğunu hatırlayalım.




Ferritin Genetiği

İnsanlarda H-geninin yaklaşık 16 kopyası ve L-geninin 5 kopyası tespit edilmiştir ancak çoğunda intronsuz pseudogen vardır [28].Bir tedavi yöntemi olan mitokondriyal ferritin (MtF) 5q23.1 kromozomunda intronsuz genler tarafından kodlanır. MtF mitokondriyal demir homeostazında ve hem sentezinin düzenlenmesinde rol oynar [29]. Omurgalılarda sitoplazmik ferritin genlerinin yapısında 3 intron ve 4 ekzon olduğu gösterilmiştir [30].



Sitokinler ve İnflamasyonunun Rolü

TNF-α ve interlökin 1-α transkripsiyonel olarak ferritinin H zincirini indükler. Ferritin salgılanması sitokinler tarafından uyarılır. Ferritin regülasyonu üzerinde inflamasyon ve stres ile ilişkili yolakların etkisi olduğu düşünülmektedir.[31-32].Yapılan çalışmalarda insan hepatositlerinin kültüründe IL-1α ve IL-6 ile indüklenen ferritinin salınmasın da 24 saatte temel bir düşüş izlenmiştir.



Hormonlar, İkincil Mesajcılar ve Büyüme Faktörleri Tarafından Ferritin Regülasyonu

İnsan ferritin H genlerinin transkripsiyonu, cAMP içeren hem hormon hem de ikincil mesajcılara yanıt olarak indüklenir. İnsan ferritin H genlerinin proksimal promotorunda bu yanıtlara aracı olan cis etkili elementler küçük bölgede eşlenmiştir [figüre13].Ferritin H genlerinden farklı olarak tanımlanan 2 grup gen kemirgen hücrelerinde trotropine yanıt olarak ekspre edilmiştir [60-61]. Sonraki çalışma da farklı kinetiği de olsa ferritin H transkriptinin üzerinde trotropine etkisi dibutiril-cAMP ile özetlenmiştir [62]. cAMP-bağımlı ferritin indüksiyonu sıçanda ki bir tiroit hücre hattında RAS tarafından inhibe edilmiştir [63].Bu deneyler de trotropin,ferritin H nin transkripsiyonunu arttırmıştır, muhtemelen cAMP ‘de yükseltgenmiştir.




Figür 13

Sıçan geninde düzenleyici bölgeler transkripsiyonel başlangıç ​​ bölgesinde 4 kb ve 5 kb arasında yer alır, insan genlerinde ise düzenleyici bölgeler TATA box’un 5’ bölgesinde yer alır. Bununla birlikte, benzer sekans motifleri ve bağlayıcı proteinler bu genlerin benzer fonksiyonel regülasyonunda rol oynadığını göstermektedir.




Hemoglobinin Ferritin İle İlişkisi

Son zamanlarda yeni bir mitokondriyal ferritin geni rapor edilmiştir[20].Bu intronsuz gen mitokondriyal lokalizasyon sinyali içerir ve mitokondriyal matriksinde eksprese edilir. Hemoglobin anahtarı olarak Ferritin H için yeni bir rol ileri sürülmüştür.(Broyles et.all). Yapılan çalışmalarda beta globin promotöründe korunmuş bir CAGTGC motifine ferritin H proteinin spesifik bağlanması ortaya çıkarılmıştır [33].

Geçici transfeksiyon deneylerinde beta globin sentezinin ferritin H tarafından bastırıldığı ortaya koymuştur. Bu da ferritinin hemoglobin anahtarı olarak bir rol oynayabileceğini düşündürür.

Oksidantlar Tarafından Ferritin Regülasyonu

Ferritinin önemli fonksiyonlarından biri, reaktif oksijen türevlerinin(ROS) oluşumunu önlemek için Fe(II) birikimini engellemektir. Bu radikaller düşük yoğunluklu lipoprotein oksidasyonuna (LDL) sebep olurlar.

Oksidantlar organizmanın yaşamını her zaman tehlikeye sokar. Eksojen ve endojen hücresel kaynakların her ikisi de oksidant stresinde ferritin regülasyon yolağını aktif hale getirir. Oksidant strese karşı koruyucu olan ferritin için güçlü deneysel kanıtlar vardır:

Yapılan çalışmalar da endotel hücreleri Heme maruz kaldığında ferritin sentezinin indüklendiği ve buna paralel olarak hidrojen peroksidin sitotoksik yanıtın azaltılmış olduğu görülmüştür. [34]

Demir tarafından üretilen ROS özellikle, bazı tümör baskılayıcı genleri hedef alır. Tümör hücrelerinde oksidantlara duyarlılık ferritin protein düzeyleri ile ters korelasyon göstermiştir, Hem ile ferritin seviyelerinin modülasyonu oksidant duyarlılığını değiştirebilir [35]

Ferritin düzeylerinde ki artış düşük molekül ağırlıklı ("kararsız" veya "düzenleyici") demir havuzunu daha da azaltır. Bu sonuçlar ile yeni gözlemler uyumludur [36]. Bunlar pro-oksidan sitotoksisite hücrelerinde ferritin duyarlılığında ki azalma ile de uyumludur [37], ferritin bu aşırı expresyonu oksidantlar ile karşılaşan hücrelerinde oksidant türlerini [37,38] ve oksidant toksisitesini azaltır [39], bunun yanı sıra, oksidant toksisite sınırlandırılmasında ferritin H ferroxidase aktivitesi önemlidir [40]


Ferritin İlişkili Hastalıklar

Ferritinin normal değerleri Erkeklerde 12-300 ng/mL, Dişilerde, 12-150 ng/mL ‘dır. Her şeyde olduğu gibi ferritin molekülünün de seviyesi değiştikçe homeostazi bozulur. Buna bağlı olarak ferritin seviyesinin artmasına ve azalmasına ilişkin hastalıklar aşağıda verilmiştir:



Normalden fazla olduğu durumlarda;

  • Hemakromatis,

  • Alkolik karaciğer hastalığı,

  • Kırmızı kan hücrelerinin sıklıkla transfüzyonu,

  • Pulmoner hemosiderozis

Normalden az olduğu durumlarda;

  • Ağır menstrüal kanama,

  • Demir eksikliği anemisi,

  • Uzun süreli sindirim sistemi kanaması.

Bunların yanı sıra çeşitli kanser ve nöropsikiyatrik hastalıklarda da ferritin karşımıza çıkmaktadır.

Kanserde ferritin

Kolorektal kanser [41], karaciğer kanseri [42], böbrek kanseri [43], meme kanseri [44], akciğer ve mide kanseri [45] ‘nde rol oynar.



Nöropsikiyatrik Hastalıklarda Ferritin,

Alzeihmer [46], Parkinson[47], Restless Leg Sendromu[48], ADHD [49], Multiple Sklerozis [50]’de rol oynar.



Mycobacterium tuberculosis ve Ferritin

Daha önce ferritin molekülünün evrimsel süreçte korunduğu ve tüm canlılarda bulunduğuna değinilmişti. Buna örnek Mycobacterium tuberculosis(Mtb) bakterisi verilebilir. Mtb gemonu 2 ferritin paraloğuna sahiptir, BfrA/Rv1876 kristal yapısı, hem-içeren bacterioferritindir[figür-14], son zamanlarda rapor edilmiştir [51]. BfrB/Rv3841,ise hem içermeyen bakteri ferritinidir. BfrB molekül ağırlığı, 20,000 Da’dur,

Organizma demir yönünden zengin ortamda kültüre edildiğinde mikobakteriyel ferritinlerin her ikiside upregüle olmasına rağmen, sabit fazda ki adaptasyonve düşük oksijen seviyesinde BfrB seviyesinin fazla olduğu bulunmuştur.


Figür-14

Mycobacterium tuberculosis’de ferritinin 3 boyutlu moleküler gösterimi

Bakteri ferritini tarafından demir alım sürecinde ilk adım iki çekirdekli demir merkezi aracılığıyla moleküler oksijen ile ferröz demirin oksidasyonudur. Di-demir merkezi,tipik olarak histidin ve glutamat aminoasitlerini içerir.



Mycobacterium tuberculosis’in demir bağımlı regülatörü (IdeR), demir konsantrasyonunda etkili genlerin bir repertuarını düzenlemek için gösterilmiştir [Rodriguez et.al.2002]

Demir alımı ve Mycobacterium tuberculosis demir depolama yolları büyüme ve hastalığa neden olma yeteneği ile bağlantılı olduğu bulunmuştur.[52-53-54-55]. Bu nedenle, mikobakteriyel ferritinlerde demir depolama tüberküloz tedavisinin gelişimi için cazip hedefleri temsil etmektedir (56-57-58-59)



Sonuç

Demir hücrede birçok işlev için gereklidir, ancak ferröz formunda serbest olarak bulunması oksidatif hasara yol açtığı için bir o kadar da toksik bir elementtir. Bu toksik etkiden korunmak için demirin ferrik formunda ferritinden atılması gerekir. Ferritin genel olarak sitoplazmik demir bağlayıcı protein olarak düşünülse de son zamanlarda demir taşımada da görevi olduğu bildirilmektedir ve kan beyin bariyerini geçebilmektedir. . Bu da hücrelerin ihtiyacı olan demirin ferritin tarafından taşınabileceğini düşündürmektedir Evrimsel süreçte yapısı korunduğu için bütün canlılarda bulunur ve çoğunlukla aynı fonksiyonları vardır Ferritinin birçok hastalıkta anahtar rol oynadığı görüşü yapılan çalışmalarla desteklenmiştir. Ancak sadece ferritin konsantrasyonunun varlığı tek başına hastalığın etyolojisinde rol oynamaz. Ancak ferritin için henüz cevaplanmamış bir sürü soru vardır. Dolayısıyla bu konuda daha net bilgilere ulaşmak ve mekanizmaların aydınlatılması için daha kapsamlı çalışmalara ihtiyaç vardır.



Referanslar

1. Lawson DM, Artymiuk PJ, Yewdall SJ, Smith JM, Livingstone JC, et al. (1991) Solving the structure of human H ferritin by genetically engineering intermolecular crystal contacts. Nature 349: 541–544.

2. Toussaint L, Bertrand L, Hue L, Crichton RR, Declercq JP (2007) Highresolution X-ray structures of human apoferritin H-chain mutants correlated with their activity and metal-binding sites. J Mol Biol 365: 440–452.

3. Ha Y, Shi D, Small GW, Theil EC, Allewell NM (1999) Crystal structure of bullfrog M ferritin at 2.8 A resolution: analysis of subunit interactions and the binuclear metal center. J Biol Inorg Chem 4: 243–256.

4. Trikha J, Theil EC, Allewell NM (1995) High resolution crystal structures of amphibian red-cell L ferritin: potential roles for structural plasticity and solvation in function. J Mol Biol 248: 949–967.

5. Trikha J, Waldo GS, Lewandowski FA, Ha Y, Theil EC, et al. (1994) Crystallization and structural analysis of bullfrog red cell L-subunit ferritins.Proteins 18: 107–118.

6. Granier T, Gallois B, Dautant A, Langlois d’Estaintot B, et al. (1997) Comparison of the structures of the cubic and tetragonal forms of horse-spleen apoferritin. Acta Crystallogr D Biol Crystallogr 53: 580–587.

7. Michaux MA, Dautant A, Gallois B, Granier T, d’Estaintot BL, et al. (1996) Structural investigation of the complexation properties between horse spleen apoferritin and metalloporphyrins. Proteins 24: 314–321.

8. Masuda T, Goto F, Yoshihara T, Mikami B (2010) Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin. J Biol Chem 285: 4049–4059.

9. Hamburger AE, West AP, Jr., Hamburger ZA, Hamburger P, Bjorkman PJ (2005) Crystal structure of a secreted insect ferritin reveals a symmetrical arrangement of heavy and light chains. J Mol Biol 349: 558–569.

10. Stillman TJ, Hempstead PD, Artymiuk PJ, Andrews SC, Hudson AJ, et al. (2001) The high-resolution X-ray crystallographic structure of the ferritin (EcFtnA) of Escherichia coli; comparison with human H ferritin (HuHF) and the structures of the Fe(3+) and Zn(2+) derivatives. J Mol Biol 307: 587–603.

11. Tatur J, Hagen WR, Matias PM (2007) Crystal structure of the ferritin from the hyperthermophilic archaeal anaerobe Pyrococcus furiosus. J Biol Inorg Chem 12: 615–630.

12. Johnson E, Cascio D, Sawaya MR, Gingery M, Schroder I (2005) Crystal structures of a tetrahedral open pore ferritin from the hyperthermophilic archaeon Archaeoglobus fulgidus. Structure 13: 637–648.

13. Cho KJ, Shin HJ, Lee JH, Kim KJ, Park SS, et al. (2009) The crystal structure of ferritin from Helicobacter pylori reveals unusual conformational changes for iron uptake. J Mol Biol 390: 83–98.

14. Ilari A, Stefanini S, Chiancone E, Tsernoglou D (2000) The dodecameric ferritin from Listeria innocua contains a novel intersubunit iron-binding site. Nat Struct Biol 7: 38–43.

15. Macedo S, Romao CV, Mitchell E, Matias PM, Liu MY, et al. (2003) The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans. Nat Struct Biol 10: 285–290.

16. Ren B, Tibbelin G, Kajino T, Asami O, Ladenstein R (2003) The multi-layered structure of Dps with a novel di-nuclear ferroxidase center. J Mol Biol 329:467–477.

17.Arosio P, Yokota M, Drysdale JW. Structural and immunological relationships of isoferritins in normal and malignant cells. Cancer Res. 1976;36:1735-1739.

18.Caskey JH, Jones C, Mills KHG, Seligman PA. Human ferritin gene is assigned to chromosome.Proc Natl Acad Sci U S A. 1983;80:482-486.

19.Worwood M, Brook JD, Cragg SJ, et al. Assignment of human ferritin genes to chromosomes 11 and 19q13.3–-19qter. Hum Genet. 1985;69:371-374.

20.Levi S, Corsi B, Bosisio M, et al. A human mitochondrial ferritin encoded by an intronless gene. J Biol Chem. 2001;270:24437-24440.

21.Muntane-Relat J, Ourlin JC, Domergue J, Maurel P. Differential effects of cytokines on the inducible expression of CYP1A1, CYP1A2, and CYP3A4 in human hepatocytes in primary culture. Hepatology 1995; 22: 1143-53

22.Halliwell B, Gutteridge JM. Protection against oxidants in biological systems: the superoxide theory of oxygen toxicity. In: Free radicals in biology and medicine. New York, NY: Oxford University Press; 1989:86-179.

23.Torti SV, Kwak EL, Miller SC, et al. The molecular cloning and characterization of murine ferritin heavy chain, a tumor necrosis factor-inducible gene. J Biol Chem. 1988;263:12638-12644.

24.Lipschitz DA, Cook JD, Finch CA. A clinical evaluation of serum ferritin as an index of iron tores. NEng J Med. 1974;290:1213-1216.

25.Torti SV, Torti FM. Iron and ferritin in inflammation and cancer. Adv Inorg Biochem. 1994;10:119-137.

26.Santambrogio P, Cozzi A, Levi S, Arosio P. Human serum ferritin G-peptide is recognized by anti-L ferritin subunit antibodies and concanavalin-Br J Haematol. 1987;65:235-237.

27.Beaumont C, Leneuve P, Devaux I, et al. Mutation in the iron responsive element of the L ferritin mRNA in a family with dominant hyperferritinaemia and cataract. Nat Genet. 1995;11:444-446.

28.Caskey JH, Jones C, Miller YE, Seligman PA. Human Ferritin gene is assigned to chromosome 19. Proc Natl Acad Sci USA 1983; 80: 482-6.

29.Levi S, Corsi B, Bosisio M, Invernizzi R, Volz A, Sanford D, et al. A human mitochondrial ferritin encoded by an intronless gene. J Biol Chem 2001; 276: 24437-40.

30.Harrison PM, Ford GC, Smith JM, White JL. The location of exon boundaries in the multimeric ironstorage protein ferritin. Biol Met. 1991;4:95-99.

31.Torti SV, Kwak EL, Miller SC, et al. The molecular cloning and characterization of murine ferritin heavy chain, a tumor necrosis factor-inducible gene. J Biol Chem. 1988;263:12638-12644.


32.Wei Y, Miller SC, Tsuji Y, Torti SV, Torti FM. Interleukin1 induces ferritin heavy chain in human muscle cells. Biochem Biophys Res Commun. 1990;169:289-296.
33. Broyles RH, Belegu V, DeWitt CR, et al. Specific repression of _-globin promoter activity by nuclear ferritin. Proc Natl Acad Sci U S A. 2001; 98:9145-9150.
34.Balla G, Jacob HS, Balla J, et al. Ferritin: a cytoprotective antioxidant strategem of endothelium. J Biol Chem. 1992;267:18148-18153.
35. Cermak J, Balla J, Jacob HS, et al. Tumor cell heme uptake induces ferritin synthesis resulting in altered oxidant sensitivity: possible role in chemotherapy efficacy. Cancer Res. 1993;53:5308-5313.
36. Picard V, Epsztejn S, Santambrogio P, Cabantchik ZI, Beaumont C. Role of ferritin in the

control of the labile iron pool in murine erythroleukemia cells. J Biol Chem. 1998;273:15382-

15386.
37.Orino K, Tsuji Y, Torti FM, Torti SV. Adenovirus E1A blocks oxidant-dependent ferritin induction and sensitizes cells to pro-oxidant cytotoxicity. FEBS Lett. 1999;461:334-338.,
38. Orino K, Lehman L, Tsuji Y, Ayaki H, Torti SV, Torti FM. Ferritin and the response to oxidative stress. Biochem J. 2001;357:241-247.
39. Epsztejn S, Glickstein H, Picard V, et al. H-ferritin subunit overexpression in erythroid cells reduces the oxidative stress response and induces multidrug resistance properties. Blood. 1999;94:3593-3603.
40. Cozzi A, Corsi B, Levi S, Santambrogio P, Albertini A, Arosio P. Overexpression of wild type and mutated human ferritin H-chain in HeLa cells—in vivo role of ferritin ferroxidase activity. J Biol Chem. 2000;275:25122-25129.
41.Wurzelmann JI, Silver A, Schreinemachers DM, Sandler RS, Everson RB. Iron intake and the risk of colorectal cancer. Cancer Epidemiol Biomarkers Prev 1996; 5: 503-7

42.Horvath ME, Faux SP, Blazovics A, Feher J. Lipid and DNA oxidative damage in experimentally induced hepatic porphyria in C57BL/10ScSn mice. Z Gastroenterol 2001; 39: 453-455.

43.Wyllie S, Liehr JG. Release of iron from ferritin storage by redox cycling of stilbene and steroid estrogen metabolites: a mechanism of induction of free radical damage by estrogen. Arch Biochem Biophys 1997; 346: 180-86.

44. Leu CM, Wong FH, Chang C, Huang SF, Hu CP. Interleukin-6 acts as an antiapoptotic factor in human esophageal carcinoma cells through the activation of both STAT3 and mitogen-activated protein kinase pathways. Oncogene 2003; 22(49): 7809-7818.


45. Rodriguez V, Tardon A, Kogevinas M, Prieto CS, Cueto A, Garcia M et al. Lung cancer risk in iron and steel foundry workers: a nested case control study in Asturias. Spain Am J Ind Med 2000; 38: 644-50.
46.Pinero DJ, Hu J,Conner JR. Alteration in the interaction between iron regulatory proteins and their iron responsive element in normal and Alzeihmer’s diseased brain. Cell Mol Biol 2000;46(4):761-76.
47. Jellinger K, Paulus W, Iqbal IG, Riederer P, Youdim MBH. Brain iron and ferritin in parkinson’s and alzeihmer’s disease. Journal of Neural Transmission. 1990;2(4): 327-40.

48. Mizuno S, Mihara T, Miyaoka T ,Inagaki T , Horiquchi J. Cerebrospinal fluid iron , ferritin and transferrin levels in restless leg syndrome.J Sleep Res 2005;14(1):43-7.

49. Oner O, Kaya OY, Oner AP. Relation of ferritin levels with symptom rating and cognitive performance in children with attention deficit hyperactivity disorder. Pediatrics International 2008;50:40-44.
50. Ge Y, Jenson JH, Lu H Helpern JA, Miles L, Inglese M et al. Quantitative assessment of iron accumulation in the deep gray matter of multiple sclerosis by magnetic field correlation imaging. Am J Neuroradiology 2007; 28:1639-44.
51. Gupta V, Gupta RK, Khare G, Salunke DM, Tyagi AK (2009) Crystal structure

of Bfr A from Mycobacterium tuberculosis: incorporation of selenomethionine results in

cleavage and demetallation of haem. PLoS One 4: e8028

52.Ratledge C (2004) Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 84:

110–130.
53. Ratledge C, Dover LG (2000) Iron metabolism in pathogenic bacteria. Annu

Rev Microbiol 54: 881–941.


54. Rodriguez GM (2006) Control of iron metabolism in Mycobacterium

tuberculosis. Trends Microbiol 14: 320–327.


55. Rodriguez GM, Smith I (2003) Mechanisms of iron regulation in mycobacteria:

role in physiology and virulence. Mol Microbiol 47: 1485–1494.


56.Garbe TR, Hibler NS, Deretic V (1999) Response to reactive nitrogen intermediates in Mycobacterium tuberculosis: induction of the 16-kilodalton alpha-crystallin homolog by exposure to nitric oxide donors. Infect Immun 67: 460–465.
57. Park HD,Guinn KM,Harrell MI,Liao R,Voskuil MI,(2003)Rv3133c/dosR is transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis48: 833–843.
58. Voskuil MI (2004) Mycobacterium tuberculosis gene expression during environmental conditions associated with latency. Tuberculosis (Edinb) 84:138–143.
59. Voskuil MI, Visconti KC, Schoolnik GK (2004) Mycobacterium tuberculosis gene expression during adaptation to stationary phase and low-oxygen dormancy. Tuberculosis (Edinb) 84: 218–227.
60.Ursini MV, de Franciscis V. TSH regulation of ferritin H chain messenger RNA levels in the rat thyroids. Biochem Biophys Res Commun. 1988;150: 287-295.
61. Cox F, Gestautas J, Rapoport B. Molecular cloning of cDNA corresponding to mRNA species whose steady state levels in the thyroid are enhanced by thyrotropin: homology of one of these sequences with ferritin H. J Biol Chem. 1988;263: 7060-7067.
62. Chazenbalk GD, Wadsworth HL, Rapoport B. Transcriptional regulation of ferritin H Messenger RNA levels in FRTL5 rat thyroid cells by thyrotropin. J Biol Chem. 1990;265:666-670.
63.Gallo A, Feliciello A, Varrone A, Cerillo R, Gottesman ME, Avvedimento VE. Ki-ras oncogene interferes with the expression of cyclic AMP-dependent promoters. Cell Growth Differ. 1995;6:91-95.

Figürler :Iron Use and Storage in the Body: Ferritin and Molecular Representations Iron in Biology: Study of the Iron Content in Ferritin, The Iron-Storage Protein.Authors:Rachel Casiday and Gerigna Frey Department of Chemistry,Washington Unibsersity St.Louis,MO 63130 adlı makaleden alınmıştır.

Dostları ilə paylaş:


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©muhaz.org 2017
rəhbərliyinə müraciət

    Ana səhifə