Webmaster's Note: As Gerard says below, his Fourth Report came in two parts
Yüklə 3,49 Mb.
|
| gb|AAK13589.1| rRNA intron-encoded homing endonuclease [Ory... 52 4e-005
ref|XP_525925.1| PREDICTED: similar to rRNA intron-encoded ... 50 1e-004 gb|AAP92584.1| Ab2-057 [Rattus norvegicus] >gi|32492570|gb|... 47 0.001 emb|CAH00948.1| unnamed protein product [Kluyveromyces lact... 42 0.022 emb|CAH00942.1| unnamed protein product [Kluyveromyces lact... 42 0.022 ref|XP_578848.1| PREDICTED: similar to Ac1147 [Rattus norve... 41 0.049 ref|XP_578845.1| PREDICTED: similar to Ac1147 [Rattus norve... 41 0.049 ref|ZP_00396973.1| hypothetical protein DgeoDRAFT_0651 [Dei... 39 0.24 gb|EAL83773.1| hypothetical protein DgeoDRAFT_1879 [Deinoco... 39 0.24 gb|AAN36071.1| hypothetical protein PF11_0493 [Plasmodium f... 37 1.2 >gb|AAK13589.1| rRNA intron-encoded homing endonuclease [Oryza sativa] Length = 66 Score = 51.6 bits (122), Expect = 4e-005 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2
V+ TP P+ +S+GSGGSMVARLKLKGIDGRA Sbjct: 24 VAYRTPPAPYEKSKSLGSGGSMVARLKLKGIDGRA 58 Score = 35.4 bits (80), Expect = 2.7 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Frame = +1 Query: 127 RRSDTVVVLTINDADQG*DSVHLDSFRT----LEKSRVYGFWGEYGRKAET*RN*RKGTQ 294 RRSDTV+V TINDADQG V ++RT EKS+ G G + + + Sbjct: 4 RRSDTVLVSTINDADQGSADV---AYRTPPAPYEKSKSLGSGGSMVARLKLKGIDGRAPP 60
VEPAA
Sbjct: 61 GVEPAA 66 -------------------- gnl|ti|818419866 name:POAA-aaa81j18.g1 mate_pair:818419554 (900 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAX26869.1| unknown [Schistosoma japonicum] 62 4e-008 gb|EAA16547.1| hypothetical protein [Plasmodium yoelii yoelii] 50 8e-005 dbj|BAD46202.1| hypothetical protein [Oryza sativa (japonic... 50 1e-004 emb|CAH00932.1| unnamed protein product [Kluyveromyces lact... 41 0.065 gb|AAT85329.1| protocadherin cluster 1 gamma 1 [Danio rerio] 39 0.25 gb|EAA21329.1| hypothetical protein [Plasmodium yoelii yoelii] 37 0.93 ref|XP_800322.1| PREDICTED: hypothetical protein XP_795229,... 36 2.1 gb|EAA18799.1| hypothetical protein [Plasmodium yoelii yoelii] 35 3.5 emb|CAG01157.1| unnamed protein product [Tetraodon nigrovir... 35 3.5 >gb|AAX26869.1| unknown [Schistosoma japonicum] Length = 102
Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -1
++R L RS AVLTCKS V+ YRGER IE SSWFPPKFPSG Sbjct: 60 SQRKLWWRSVAVLTCKSVVRPGYRGERLIEPSSSWFPPKFPSG 102 Score = 34.3 bits (77), Expect = 6.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 649 ACHVRSRKTTSYA*VGRSQEKSWWKVV 569 + VR+RK +YA GRSQ K WW+ V Sbjct: 43 SARVRTRKMVNYAWAGRSQRKLWWRSV 69 --------------- gnl|ti|818419569 name:POAA-aaa81n02.b1 mate_pair:818419881 (903 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAW29072.1| DEAD box helicase PL10 [Nematostella vectensis] 54 6e-006 gb|EAA07964.2| ENSANGP00000017541 [Anopheles gambiae str. P... 54 7e-006 gb|AAO15914.1| vasa-like [Schistocerca gregaria] 52 4e-005 dbj|BAA19572.1| DEAD family RNA helicase~germ cell specific... 51 5e-005 gb|AAO76992.1| putative ATP-dependent RNA helicase [Bactero... 51 6e-005 gb|AAL90351.1| RE28061p [Drosophila melanogaster] 50 8e-005 emb|CAG86342.1| unnamed protein product [Debaryomyces hanse... 50 8e-005 gb|AAF54262.1| CG9748-PA [Drosophila melanogaster] >gi|1798... 50 8e-005 emb|CAJ15141.1| PL10b protein [Platynereis dumerilii] 50 1e-004 emb|CAJ15140.1| PL10a protein [Platynereis dumerilii] 50 1e-004 >gb|AAW29072.1| DEAD box helicase PL10 [Nematostella vectensis] Length = 288 Score = 54.3 bits (129), Expect = 6e-006 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3
+LLVATPGRL DM++ GR V LDSI+FLVLDEADRML F Sbjct: 82 HLLVATPGRLVDMMDRGR--VGLDSIRFLVLDEADRMLDMGF 121 Score = 34.7 bits (78), Expect = 4.7 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = -3 Query: 118 AMPKN--RQTLLFSATFPDEILQMANSYLK 35 +MPK RQTL+FSATFP EI +A +L+ Sbjct: 133 SMPKTGIRQTLMFSATFPKEIQMLARDFLE 162 --------------------------- gnl|ti|818419881 name:POAA-aaa81n02.g1 mate_pair:818419569 (869 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|ZP_00108485.1| COG2114: Adenylate cyclase, family 3 (so... 69 2e-010 ref|ZP_00671488.1| Guanylate cyclase:Response regulator rec... 68 5e-010 ref|ZP_00671494.1| PAS:Ammonium transporter [Trichodesmium ... 66 1e-009 gb|AAR02408.1| soluble guanylyl cyclase beta [Chlamydomonas... 65 2e-009 ref|XP_685077.1| PREDICTED: similar to Adenylate cyclase, t... 65 2e-009 ref|ZP_00108745.1| COG2114: Adenylate cyclase, family 3 (so... 65 3e-009 dbj|BAB19924.1| adenylate cyclase [Spirulina platensis] 65 4e-009 ref|XP_798394.1| PREDICTED: similar to Adenylate cyclase, t... 65 4e-009 gb|AAW30401.1| adenylate cyclase [Aplysia californica] 64 7e-009 ref|ZP_00672841.1| PAS [Trichodesmium erythraeum IMS101] >g... 63 1e-008 >ref|ZP_00108485.1| COG2114: Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Nostoc punctiforme PCC 73102] Length = 149
Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = +2
W DT+N ASRMES G G IQVTE +Y +L KF F+KR I VKGKG MTTY L Sbjct: 90 WGDTLNIASRMESQGIVGKIQVTEDIYKSLCNKFLFQKRGEIEVKGKGKMTTYFL 144 ------------------------ gnl|ti|818419884 name:POAA-aaa81n10.g1 mate_pair:818419573 (294 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAC04429.1| unnamed protein product [Homo sapiens] 80 3e-014 ref|XP_596986.2| PREDICTED: similar to ATPase family, AAA d... 80 3e-014 ref|XP_039676.4| PREDICTED: KIAA1240 protein [Homo sapiens] 80 3e-014 ref|XP_419982.1| PREDICTED: similar to two AAA domain conta... 80 3e-014 ref|XP_858149.1| PREDICTED: similar to ATPase family, AAA d... 80 3e-014 ref|XP_532888.2| PREDICTED: similar to ATPase family, AAA d... 80 3e-014 gb|AAH81936.1| Hypothetical protein LOC500625 [Rattus norve... 80 3e-014 ref|XP_356572.2| PREDICTED: similar to Hypothetical protein... 80 3e-014 ref|XP_640671.1| AAA ATPase domain-containing protein [Dict... 78 8e-014 ref|XP_418453.1| PREDICTED: similar to two AAA domain conta... 78 8e-014 >dbj|BAC04429.1| unnamed protein product [Homo sapiens] Length = 574 Score = 79.7 bits (195), Expect = 3e-014 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2
P IFFDEIDGLAPVRSS+QDQIHSSIVSTLLALMDGLDNRG + Sbjct: 499 PSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGEI 542 ---------------------- gnl|ti|818419893 name:POAA-aaa81p04.g1 mate_pair:818419579 (872 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_689550.1| PREDICTED: similar to Anaphase promoting c... 57 8e-007 emb|CAG02261.1| unnamed protein product [Tetraodon nigrovir... 53 1e-005 dbj|BAE41951.1| unnamed protein product [Mus musculus] 48 5e-004 dbj|BAC98161.1| mKIAA1406 protein [Mus musculus] 48 5e-004 gb|AAI07472.1| Unknown (protein for IMAGE:7446651) [Rattus ... 48 5e-004 ref|NP_780509.1| anaphase-promoting complex subunit 2 [Mus ... 48 5e-004 gb|AAH27351.1| Anapc2 protein [Mus musculus] 48 5e-004 dbj|BAE32605.1| unnamed protein product [Mus musculus] 48 5e-004 ref|XP_215994.3| PREDICTED: similar to mKIAA1406 protein [R... 48 5e-004 ref|XP_548357.2| PREDICTED: similar to Anaphase promoting c... 47 7e-004 >ref|XP_689550.1| PREDICTED: similar to Anaphase promoting complex subunit 2 (APC2) (Cyclosome subunit 2) [Danio rerio] Length = 793
Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -3
C +Y N RI E+FS+I DFPES P ++DL CL +T+Q + L+A+LK ++ Sbjct: 302 CRIYVNMRIEELFSIIRDFPESTPAIEDLKFCLERTNQRQQLLASLKSAF 351 --------------- gnl|ti|818419581 name:POAA-aaa81p08.b1 mate_pair:818419895 (401 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_794540.1| PREDICTED: similar to retinol dehydrogenas... 49 6e-005 ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reduct... 48 9e-005 gb|AAF59216.3| CG30491-PA [Drosophila melanogaster] >gi|214... 47 2e-004 ref|XP_425577.1| PREDICTED: similar to dehydrogenase/reduct... 47 2e-004 ref|XP_421193.1| PREDICTED: similar to double substrate-spe... 47 2e-004 ref|XP_781957.1| PREDICTED: similar to dehydrogenase/reduct... 47 2e-004 ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reduct... 47 3e-004 ref|XP_786908.1| PREDICTED: similar to alcohol dehydrogenas... 47 3e-004 ref|NP_909282.1| putative pod-specific dehydrogenase SAC25 ... 46 4e-004 ref|XP_788671.1| PREDICTED: similar to retinol dehydrogenas... 46 5e-004 >ref|XP_794540.1| PREDICTED: similar to retinol dehydrogenase 12, like [Strongylocentrotus purpuratus] Length = 319
Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -2
KLDLAS KSIREFAEE K ++ LHVL+NN + P Sbjct: 96 KLDLASMKSIREFAEEIKREEKSLHVLLNNAGVMMCP 132 -------------------- gnl|ti|818417538 name:POAA-aaa82a11.b1 mate_pair:820218711 (892 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 68 4e-010 gb|AAK21974.1| rRNA promoter binding protein [Rattus norveg... 67 6e-010 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 60 8e-008 gb|EAA21327.1| putative senescence-associated protein [Plas... 52 4e-005 ref|XP_767406.1| hypothetical protein GLP_748_1200_211 [Gia... 50 8e-005 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 44 0.006 dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum] 43 0.013 pir||A35664 PpoI endonuclease - slime mold (Physarum polyce... 40 0.14 gb|AAB65764.1| endonuclease [Physarum polycephalum] 40 0.14 pir||T02955 probable cytochrome P450 monooxygenase - maize ... 38 0.41 >ref|XP_578859.1| PREDICTED: similar to hypothetical protein [Rattus norvegicus] Length = 135 Score = 68.2 bits (165), Expect = 4e-010 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -1
+P DDEAFGYLKRVIVTPAVYP + F HF+IQSTGQKS V T Sbjct: 69 VPGADDEAFGYLKRVIVTPAVYPRFIEFLHFDIQSTGQKSHRVNT 113 ------------------- gnl|ti|820218711 name:POAA-aaa82a11.g1 mate_pair:818417538 (903 letters)
Score E
Sequences producing significant alignments: (bits) Value dbj|BAB33421.1| putative senescence-associated protein [Pis... 69 2e-010 gb|AAS66225.1| LRRG00134 [Rattus norvegicus] 69 3e-010 ref|XP_577589.1| PREDICTED: similar to LRRG00134 [Rattus no... 64 9e-009 ref|XP_648070.1| conserved hypothetical protein [Entamoeba ... 56 1e-006 gb|AAR25995.1| putative senescence-associated protein [Pyru... 54 1e-005 ref|XP_665229.1| senescence-associated protein [Cryptospori... 47 7e-004 ref|XP_578859.1| PREDICTED: similar to hypothetical protein... 47 0.001 gb|EAA18798.1| hypothetical protein [Plasmodium yoelii yoelii] 45 0.005 gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] 45 0.005 gb|EAA21327.1| putative senescence-associated protein [Plas... 44 0.010 >dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 69.3 bits (168), Expect = 2e-010 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2
VNNPTL EFCF+MIGRADIEGSKS+VAMNAW PQAS Sbjct: 79 VNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQAS 114 Score = 39.7 bits (91), Expect = 0.15 Identities = 26/51 (50%), Positives = 27/51 (52%) Frame = +3 Query: 450 SAYTIGLNHWFLSY*SDLLSGHTAAPKRLLVVK*EGKTNLSHDGLNPAHVP 602 SA T N FLSY +LL H GKTNLSHDGL PAHVP Sbjct: 34 SAMTNCANQRFLSYYVELLLRHCHQ---------WGKTNLSHDGLIPAHVP 75 ---------------- gnl|ti|820218716 name:POAA-aaa82a23.g1 mate_pair:818417543 (819 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_797681.1| PREDICTED: similar to SCY1-like 2 protein,... 53 1e-005 ref|XP_646778.1| putative SCY1 family protein kinase [Dicty... 51 5e-005 gb|EAL27813.1| GA15148-PA [Drosophila pseudoobscura] 50 1e-004 gb|AAF56841.1| CG1951-PA [Drosophila melanogaster] >gi|1786... 49 3e-004 ref|XP_395903.2| PREDICTED: similar to SCY1-like 2 protein,... 48 5e-004 emb|CAH92591.1| hypothetical protein [Pongo pygmaeus] 47 6e-004 ref|NP_932138.1| D10Ertd802e protein [Mus musculus] >gi|275... 47 6e-004 ref|NP_060458.3| SCY1-like 2 protein [Homo sapiens] >gi|396... 47 6e-004 ref|XP_539739.2| PREDICTED: similar to SCY1-like 2 protein ... 47 6e-004 ref|XP_235050.3| PREDICTED: similar to D10Ertd802e protein ... 47 6e-004 >ref|XP_797681.1| PREDICTED: similar to SCY1-like 2 protein, partial [Strongylocentrotus purpuratus] Length = 312
Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = -3
++F+K+LLER K+ +D I+R+ + LT+LRHP +L V PLEET+ + Sbjct: 55 FVFEKKLLERFAKRDRDPLLEILRKGSTQLTRLRHPCVLTVQHPLEETRESL 106 ------------------- gnl|ti|818417553 name:POAA-aaa82c19.b1 mate_pair:820218726 (882 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAK13589.1| rRNA intron-encoded homing endonuclease [Ory... 52 4e-005 ref|XP_525925.1| PREDICTED: similar to rRNA intron-encoded ... 50 1e-004 emb|CAH00949.1| unnamed protein product [Kluyveromyces lact... 49 2e-004 ref|XP_523367.1| PREDICTED: similar to rRNA intron-encoded ... 49 2e-004 gb|AAL31950.1| CDH1-D [Gallus gallus] 49 3e-004 emb|CAH00948.1| unnamed protein product [Kluyveromyces lact... 43 0.016 emb|CAH00942.1| unnamed protein product [Kluyveromyces lact... 43 0.016 ref|ZP_00396973.1| hypothetical protein DgeoDRAFT_0651 [Dei... 39 0.24 gb|EAL83773.1| hypothetical protein DgeoDRAFT_1879 [Deinoco... 39 0.24 gb|AAN36071.1| hypothetical protein PF11_0493 [Plasmodium f... 37 1.2 >gb|AAK13589.1| rRNA intron-encoded homing endonuclease [Oryza sativa] Length = 66 Score = 51.6 bits (122), Expect = 4e-005 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1
V+ TP P+ +S+GSGGSMVARLKLKGIDGRA Sbjct: 24 VAYRTPPAPYEKSKSLGSGGSMVARLKLKGIDGRA 58 Score = 35.4 bits (80), Expect = 2.6 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Frame = +3 Query: 456 RRSDTVVVLTINDADQG*DSVHLDSFRT----LEKSRVYGFWGEYGRKAET*RN*RKGTQ 623 RRSDTV+V TINDADQG V ++RT EKS+ G G + + + Sbjct: 4 RRSDTVLVSTINDADQGSADV---AYRTPPAPYEKSKSLGSGGSMVARLKLKGIDGRAPP 60
VEPAA
Sbjct: 61 GVEPAA 66 --------------------- gnl|ti|818417562 name:POAA-aaa82e13.b1 mate_pair:820218735 (715 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_642890.1| hypothetical protein DDB0168276 [Dictyoste... 112 1e-023 ref|XP_787949.1| PREDICTED: similar to nuclear matrix prote... 90 8e-017 ref|XP_392284.2| PREDICTED: similar to GA18945-PA [Apis mel... 84 4e-015 emb|CAG31141.1| hypothetical protein [Gallus gallus] 83 1e-014 gb|AAI07670.1| Unknown (protein for MGC:124562) [Rattus nor... 82 2e-014 ref|XP_867913.1| PREDICTED: similar to PRP19/PSO4 homolog (... 82 2e-014 ref|XP_867905.1| PREDICTED: similar to PRP19/PSO4 homolog (... 82 2e-014 ref|XP_867899.1| PREDICTED: similar to PRP19/PSO4 homolog (... 82 2e-014 gb|EAL21784.1| hypothetical protein CNBC4860 [Cryptococcus ... 67 4e-010 gb|AAW42213.1| nuclear matrix protein NMP200, putative [Cry... 67 4e-010 >ref|XP_642890.1| hypothetical protein DDB0168276 [Dictyostelium discoideum] gb|AAS38876.1| hypothetical protein [Dictyostelium discoideum] gb|EAL68903.1| hypothetical protein DDB0168276 [Dictyostelium discoideum] Length = 514 Score = 112 bits (280), Expect = 1e-023 Identities = 61/107 (57%), Positives = 70/107 (65%) Frame = +2
T+ + KTVKPRP TATSIPSMLQLFQNEWD+LMLET+TLKQ ET Sbjct: 52 TVKIGKTVKPRPTTATSIPSMLQLFQNEWDSLMLETFTLKQQHET--------------- 96
VRQELAH++YQ+DAACRVIARL+KERD AR+ Sbjct: 97 ----------------VRQELAHSMYQYDAACRVIARLVKERDAARS 127 -------------------------- gnl|ti|820218740 name:POAA-aaa82g05.g1 mate_pair:818417567 (715 letters)
Score E
Sequences producing significant alignments: (bits) Value ref|XP_711746.1| putative mitochondrial glutaredoxin [Candi... 49 2e-004 ref|XP_759014.1| hypothetical protein UM02867.1 [Ustilago m... 49 2e-004 gb|AAP54473.1| PKCq-interacting protein, putative [Oryza sa... 48 3e-004 gb|AAS51973.1| ADR053Wp [Ashbya gossypii ATCC 10895] >gi|45... 48 3e-004 gb|ABB47838.1| PKCq-interacting protein, putative [Oryza sa... 48 3e-004 gb|EAA72181.1| hypothetical protein FG04567.1 [Gibberella z... 48 4e-004 ref|XP_451957.1| unnamed protein product [Kluyveromyces lac... 47 5e-004 ref|XP_364697.1| hypothetical protein MG09542.4 [Magnaporth... 47 5e-004 emb|CAC21468.1| SPAPB2B4.02 [Schizosaccharomyces pombe] >gi... 47 5e-004 ref|NP_998186.1| glutaredoxin 5 [Danio rerio] >gi|37590404|... 47 6e-004 >ref|XP_711746.1| putative mitochondrial glutaredoxin [Candida albicans SC5314] ref|XP_711724.1| putative mitochondrial glutaredoxin [Candida albicans SC5314] gb|EAK92524.1| potential mitochondrial glutaredoxin [Candida albicans SC5314] gb|EAK92502.1| potential mitochondrial glutaredoxin [Candida albicans SC5314] Length = 175
Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +3
+A+ SPVVLFMKG PE P CG+SRA + IL ++G Sbjct: 49 KAVTTSPVVLFMKGTPEFPQCGFSRATIQILGQQG 83 ---------------- gnl|ti|818417584 name:POAA-aaa82i23.b1 (788 letters) Score E
Sequences producing significant alignments: (bits) Value ref|NP_918771.1| putative cyclin homolog [Oryza sativa (jap... 59 2e-007 gb|AAH97120.1| LOC553269 protein [Danio rerio] 57 5e-007 ref|XP_709840.1| PREDICTED: similar to cyclin L1 isoform 6 ... 57 5e-007 ref|XP_685537.1| PREDICTED: similar to cyclin L1 isoform 1 ... 57 5e-007 ref|XP_709838.1| PREDICTED: similar to Ccnl protein isoform... 57 5e-007 ref|XP_709839.1| PREDICTED: similar to cyclin L beta isofor... 57 5e-007 ref|NP_565622.1| RCY1; cyclin-dependent protein kinase regu... 56 1e-006 gb|AAH73707.1| LOC443688 protein [Xenopus laevis] 53 1e-005 gb|AAH94084.1| LOC443688 protein [Xenopus laevis] 53 1e-005 sp|Q6GN15|CCNL1_XENLA Cyclin-L1 53 1e-005 >ref|NP_918771.1| putative cyclin homolog [Oryza sativa (japonica cultivar-group)] dbj|BAB39257.1| putative ania-6a type cyclin [Oryza sativa (japonica cultivar-group)] Length = 427
Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = -2
Y+ +Q+ ++PSR+ GIDE TETALR++GC+LIQE+GI+L+L Sbjct: 10 YLTDEQLRDSPSRKDGIDEATETALRVYGCDLIQESGILLKL 51 Score = 39.3 bits (90), Expect = 0.15 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -1 Query: 203 LIYRPQVTMATGQVLFHRFFYRKSFREYDMK 111 L+ PQ MAT QVLFHRF+ +KSF + +K Sbjct: 48 LLKLPQAVMATAQVLFHRFYCKKSFVRFSVK 78 --------------------- gnl|ti|818417591 name:POAA-aaa82k17.b1 mate_pair:820218761 (519 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|EAA76298.1| hypothetical protein FG09509.1 [Gibberella z... 60 4e-008 ref|XP_365789.1| hypothetical protein MG02491.4 [Magnaporth... 59 7e-008 ref|XP_761175.1| hypothetical protein UM05028.1 [Ustilago m... 59 7e-008 ref|XP_473698.1| OSJNBb0016D16.17 [Oryza sativa (japonica c... 59 1e-007 gb|AAW43718.1| DNA replication helicase dna2, putative [Cry... 58 1e-007 gb|EAL89572.1| DNA replication helicase (Dna2), putative [A... 57 3e-007 ref|NP_172361.1| EMB2411; ATP-dependent DNA helicase [Arabi... 57 4e-007 pir||T00740 hypothetical protein F22O13.35 - Arabidopsis th... 57 4e-007 emb|CAG05680.1| unnamed protein product [Tetraodon nigrovir... 52 9e-006 ref|XP_241671.3| PREDICTED: similar to mKIAA0083 protein [R... 52 1e-005 >gb|EAA76298.1| hypothetical protein FG09509.1 [Gibberella zeae PH-1] ref|XP_389685.1| hypothetical protein FG09509.1 [Gibberella zeae PH-1] Length = 1562 Score = 59.7 bits (143), Expect = 4e-008 Identities = 39/98 (39%), Positives = 53/98 (54%) Frame = -2
NL+++ + + A + R+LIVDLE+P F+A P+Q R Sbjct: 1016 NLVQMMADDVFGARQIRRLIVDLEAPRFKAA-----PTQYTMSDR--------------- 1055
LNVDQR+AI V+SA+DYAL+LGMPGTGK Sbjct: 1056 -------DNLNVDQRRAIEKVMSAQDYALVLGMPGTGK 1086 ---------------- gnl|ti|818417072 name:POAA-aaa83e04.b1 mate_pair:818417350 (398 letters)
Score E
Sequences producing significant alignments: (bits) Value gb|AAS50977.1| ABR204Cp [Ashbya gossypii ATCC 10895] >gi|45... 45 6e-004 emb|CAG59611.1| unnamed protein product [Candida glabrata C... 45 0.001 gb|AAA34420.1| AMP deaminase (EC 3.5.4.6) 45 0.001 emb|CAA86620.1| AMD1 [Saccharomyces cerevisiae] >gi|1351916... 45 0.001 ref|NP_910462.1| putative AMP deaminase [Oryza sativa (japo... 44 0.001 gb|EAL84883.1| amp deaminase [Aspergillus fumigatus Af293] ... 44 0.002 Yüklə 3,49 Mb. Dostları ilə paylaş:
|